DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and pqn-25

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_741140.1 Gene:pqn-25 WormBaseID:WBGene00004114 Length:672 Species:Caenorhabditis elegans

Alignment Length:397 Identity:86/398 (22%)
Similarity:125/398 (31%) Gaps:136/398 (34%)


  Fly   118 YMNVIEVC-------CK-GWRRYEYDWSQCV--PDCGERCQENGFCVAGG-----KCVCFTDFVL 167
            |:||.:.|       |: |...|.   |||:  ...|:.||.:..|:...     .|.|..::.|
 Worm   204 YVNVNQQCVISNGLNCQLGTVSYN---SQCITLASPGQNCQTSSQCIDNSVCMNQMCTCNNNYRL 265

  Fly   168 NY------------------RNNCV------PTCPLG--CPHGRCYLNGTCQCDK------GYEL 200
            .|                  .|.||      .||...  |..|....:|||||..      ||.:
 Worm   266 VYGYCVPITSSICQQTQTLVNNQCVLLSIVGETCIANQQCVGGAMCNSGTCQCTNGATAMYGYCI 330

  Fly   201 DGSRKFCQP-------------QCNATCGHNEVCLEPGKCS---CAEGYTRGLRESAALGCQPIC 249
            ..|...|..             |...:|..::.||....|:   |...:.     |.:.....:|
 Worm   331 SSSSSSCNSNQVSINGMCYNTVQVGGSCSFSQQCLNNAVCTNNICVSTFC-----SVSCSTNQVC 390

  Fly   250 IPDCGYGH------CVRPNE-----------CECFPGFQKRKNGITCEGD--------------- 282
            |.:..|.:      ||...:           |:|..|.| :.||: |.|:               
 Worm   391 ISNQCYNYVSIGSQCVGSQQCLSNSQCISSICQCPQGTQ-QSNGV-CTGNNNNNNQCQPNQVLIN 453

  Fly   283 --CYMTCENGF-CANKTTCV----CQNGYRYDKNTTTCLPDCGDNCDNGVCISPGNCRCFKGYVR 340
              ||.|...|| |.....|:    |.|        :.|....|....||.|....|.:|....|.
 Worm   454 NQCYNTVSIGFQCQFPQQCLGNSQCMN--------SMCQCPTGSTNVNGYCQGGSNGQCNSNQVL 510

  Fly   341 NRERC-EAVCVG-GCGFYGKCIAPNVCGCAIVPGPERTYQRCEYGLCNAMGRC------RCQVGM 397
            ...:| ..|.:| .|.|..:|:..:.|..:|.        :|..|..|..|.|      :|....
 Worm   511 INNQCYNTVSIGFQCQFAQQCLGNSQCLNSIC--------QCPSGSSNVNGYCQGGSNGQCNSNQ 567

  Fly   398 TRFIDRC 404
            ..:.::|
 Worm   568 VYYNNQC 574

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NimB4NP_788046.1 None
pqn-25NP_741140.1 EB 160..211 CDD:279949 3/7 (43%)
EB 219..270 CDD:279949 14/54 (26%)
EB 278..329 CDD:279949 14/51 (27%)
EB 341..>376 CDD:279949 6/35 (17%)
EB 384..435 CDD:279949 11/53 (21%)
EB 450..496 CDD:279949 13/54 (24%)
EB 504..555 CDD:279949 14/59 (24%)
EB 563..614 CDD:279949 2/13 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.