DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NimB4 and ced-1

Sequence 1:NP_788046.1 Gene:NimB4 FlyBaseID:FBgn0028542 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_740922.1 Gene:ced-1 WormBaseID:WBGene00000415 Length:1111 Species:Caenorhabditis elegans

Alignment Length:434 Identity:103/435 (24%)
Similarity:145/435 (33%) Gaps:185/435 (43%)


  Fly   122 IEVCCKGWRRYEYDWSQCVPDCGERCQENGFCVAGGKCVCFTDFVLNYRNNCVPTCPLG------ 180
            ::.||.|:  |:.....|:|||...|:: |.|:..|||.|...:...|   |..:|.:|      
 Worm   102 VKQCCDGY--YQTKDHFCLPDCNPPCKK-GKCIEPGKCECDPGYGGKY---CASSCSVGTWGLGC 160

  Fly   181 -----CPHG-RCYLN-GTCQCDKGYELDGSRKFCQ-----PQC--NATCGHNEVCLEPGKCSCAE 231
                 |.:| .|... |||.|..|::.:...|.|.     |.|  :..|.:...|.:.|||.|::
 Worm   161 SKSCDCENGANCDPELGTCICTSGFQGERCEKPCPDNKWGPNCVKSCPCQNGGKCNKEGKCVCSD 225

  Fly   232 GYTRGLRESAALGCQPICIPDCGYG----HCVRPNECECFPGFQKRKNGITCE---GDCYMTCEN 289
            |:          |.: .|:..|..|    .|  ..||.|       :||.||:   |.|  .|::
 Worm   226 GW----------GGE-FCLNKCEEGKFGAEC--KFECNC-------QNGATCDNTNGKC--ICKS 268

  Fly   290 GF----CANKTT-----------CVCQNGYRYDKNTTTCLPDC----GDNCDNGV---------- 325
            |:    |.|:.:           |.|.|....|.::..|  .|    |.:||.|.          
 Worm   269 GYHGALCENECSVGFFGSGCTQKCDCLNNQNCDSSSGEC--KCIGWTGKHCDIGCSRGRFGLQCK 331

  Fly   326 --CISP---------------GNCRC---FKGYVRNRERCEA-----------VCV--------- 350
              |..|               |.|:|   :||...:..:|:|           .||         
 Worm   332 QNCTCPGLEFSDSNASCDAKTGQCQCESGYKGPKCDERKCDAEQYGADCSKTCTCVRENTLMCAP 396

  Fly   351 --GGC----GFYG--------------KCIAPNVC-------------GCAIVPGPERTYQRCE- 381
              |.|    ||||              .|....:|             .|...||  ||.:.|. 
 Worm   397 NTGFCRCKPGFYGDNCELACSKDSYGPNCEKQAMCDWNHASECNPETGSCVCKPG--RTGKNCSE 459

  Fly   382 ------YG-------LCN--------AMGRCRCQVGMTRFIDRC 404
                  ||       .||        |.|:|:|..|.|.  .||
 Worm   460 PCPLDFYGPNCAHQCQCNQRGVGCDGADGKCQCDRGWTG--HRC 501



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.