DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ance-3 and ace2

Sequence 1:NP_001033904.1 Gene:Ance-3 FlyBaseID:FBgn0032536 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_002938293.1 Gene:ace2 XenbaseID:XB-GENE-487117 Length:862 Species:Xenopus tropicalis

Alignment Length:602 Identity:209/603 (35%)
Similarity:331/603 (55%) Gaps:20/603 (3%)


  Fly   205 RYQQELEKLRILLVESDQKGSLECTANVAAQWNFETNVNDFTQTEALNAQQRYVEFQRITAEQSK 269
            |.|...::.|..|...:|:..:....:..|||.:.||:.|....:...|..::..|....::.|:
 Frog    18 RSQSVTDQARDFLKRFEQEAEVLYHQSALAQWEYNTNITDENAQKMSEAGAKWSAFYTNASKNSE 82

  Fly   270 RINKDLIFDRRLYRQLMLQSEVGPNALPLDVLDRYNRLLNEMLFLYNSAEICAYQQPFQCDLHYI 334
            ..|||.|.|..:..||:..||.|...||.:...|.|::||||..:|::..:|......:| |...
 Frog    83 AFNKDDITDPSIELQLIFLSEKGSAILPAEKYTRLNQVLNEMSTIYSTHAVCKPDGSKEC-LPLE 146

  Fly   335 PQLKDIMAKSRDWDELQHTWVEYHRKAGRGMRDSYEQLIDVMQEVAYVNNVTNGGEYW------- 392
            |.|..|||:|.|::|....|..:...||:.||..||:.:|:..|.|.:|...:.|:||       
 Frog   147 PGLDKIMAESIDYEERLWAWEGWRAGAGKKMRSLYEEYVDLENEAARLNGYNDYGDYWRGNYETL 211

  Fly   393 ---YLAYESGNFRQDMDIVWEQIRPLYEGLHAYVRRKLRDYYGPDRINRIAPIPSHILGNMYGQS 454
               ..||...:..:|::..:::|.|||:.|||:||..|:..||...|:....:|:|:||:|:|:.
 Frog   212 ATDMYAYSRDDLIKDVERTYQEILPLYKELHAFVRGNLQQVYGSRYISDSGCLPAHLLGDMWGRF 276

  Fly   455 WSNVLDILIPYPGRKLIDVTPRMVEQGYTPQLMFQLAEEFFTSINMSAVGPEFYRNSIFEQPLD- 518
            |:|:..:::|||.::.|||||.||.||:|.:.||:.||.||.|:::.|:...|:.||:.|:|.| 
 Frog   277 WTNLYPLMVPYPNKESIDVTPTMVAQGWTIERMFKEAEIFFKSVDLFALNENFWNNSMLEEPKDG 341

  Fly   519 RRVLCEPSAWDFCNRHDFRVKICTDINQRSLISVHHEMAHIQYFLQYRHLPKIFRNGANPAFHQA 583
            |:|:|.|:|||. ..:|||:|:||.:|....::||||:.||||.:.|...|.:.|:|||..||:|
 Frog   342 RQVVCHPTAWDL-GMNDFRIKMCTKVNMEDFLTVHHELGHIQYDMAYAKQPFMLRDGANEGFHEA 405

  Fly   584 VGDAIGLSVSTPRHLQTLGLLQRS-LDESSYDINYLFTMAIDKVAFLPFALSLDNWRYDVFSGNA 647
            ||:.:.||.:||:||:.|.||..: :::...:||:||..|:..|..|||...|:.||:.||.|..
 Frog   406 VGEIMSLSAATPKHLKHLKLLDANFVEDQETEINFLFRQALAIVGTLPFTYMLEQWRWKVFRGEI 470

  Fly   648 NKRTMNCHYWNLREKYSGIKPPVLRSEKDFDPGAKYHIPANIPYIKYFFSTVLQFQIYRGLCRES 712
            .|......:|.::.:..|:..||...|...||.|.:|:..:..:|:|:..|:.|||....||:.:
 Frog   471 PKDQWMKTWWQMKRELVGVVEPVPHDETYCDPPALFHVSNDYSFIRYYTRTIYQFQFQDALCKAA 535

  Fly   713 GQYVPGDPRKPLHQCDIYRQPAAGNILKTLMSKGASQPWQEVLEETLREGRLDGTALREYFAPLE 777
            |..      .|||.|||.....||..|:.::..|.::.|.|.|:......::|...|.:||.||.
 Frog   536 GHV------GPLHTCDITNSKEAGAKLRAMLELGKAKSWTEALQSITGGVKMDSQPLLKYFEPLF 594

  Fly   778 EWLRQENLRTNEYVGWN 794
            .||::.|........||
 Frog   595 VWLQKNNEENRRQSTWN 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ance-3NP_001033904.1 M2_ACE 216..784 CDD:188999 203/580 (35%)
ace2XP_002938293.1 M2_ACE 29..601 CDD:188999 203/580 (35%)
Collectrin 622..772 CDD:293564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D266227at33208
OrthoFinder 1 1.000 FOG0000833
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.