DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and AT5G03370

DIOPT Version :8

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_195957.1 Gene:AT5G03370 / 831859 AraportID:AT5G03370 Length:171 Species:Arabidopsis thaliana

Alignment Length:72 Identity:26/72 - (36%)
Similarity:38/72 - (52%) Gaps:2/72 - (2%)


  Fly    15 GRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSSIEKVE 79
            ||||||.:|...:..|:.||::||..|...|:|:....|.|..:|.|.:..| .|.|.:.:..:|
plant    90 GRVQGVCYRNWTVENAEQLGIKGWVRNRRDGSVEALFSGPPEAVDEMHQRCR-RGPPAAMVTGLE 153

  Fly    80 -FSSQRE 85
             |.|..|
plant   154 AFPSTEE 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 26/72 (36%)
AT5G03370NP_195957.1 Acylphosphatase 83..171 CDD:294372 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1502266at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127552
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
43.820

Return to query results.
Submit another query.