powered by:
                  
 
    
 
    
             
          
            Protein Alignment Acyp and AT5G03370
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_001285916.1 | 
            Gene: | Acyp / 34807 | 
            FlyBaseID: | FBgn0025115 | 
            Length: | 120 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_195957.1 | 
            Gene: | AT5G03370 / 831859 | 
            AraportID: | AT5G03370 | 
            Length: | 171 | 
            Species: | Arabidopsis thaliana | 
          
        
        
        
          
            | Alignment Length: | 72 | 
            Identity: | 26/72 - (36%) | 
          
          
            | Similarity: | 38/72 -  (52%) | 
            Gaps: | 2/72 - (2%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    15 GRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSSIEKVE 79 
            ||||||.:|...:..|:.||::||..|...|:|:....|.|..:|.|.:..| .|.|.:.:..:| 
plant    90 GRVQGVCYRNWTVENAEQLGIKGWVRNRRDGSVEALFSGPPEAVDEMHQRCR-RGPPAAMVTGLE 153 
 
  Fly    80 -FSSQRE 85 
             |.|..| 
plant   154 AFPSTEE 160 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Domainoid | 
            1 | 
            1.000 | 
            47 | 
            1.000 | 
            Domainoid score | 
            I4519 | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_KOG3360 | 
          
          
            | Hieranoid | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
             | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoDB | 
            1 | 
            1.010 | 
            - | 
            - | 
             | 
            D1502266at2759 | 
          
          
            | OrthoFinder | 
            1 | 
            1.000 | 
            - | 
            - | 
             | 
            FOG0001379 | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            OOG6_101060 | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SwiftOrtho | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            1 | 
            0.960 | 
            - | 
            - | 
             | 
             | 
          
          
             | 
            8 | 7.680 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.