DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and Acyp1

DIOPT Version :8

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001351289.1 Gene:Acyp1 / 66204 MGIID:1913454 Length:157 Species:Mus musculus

Alignment Length:89 Identity:36/89 - (40%)
Similarity:60/89 - (67%) Gaps:0/89 - (0%)


  Fly     8 SCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPL 72
            |.::|:||:||||.||::...:.|.|||.||..|:.||||:|.::|..:::..|::||.|.|||.
Mouse    67 SVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDRGTVQGQLQGPVSKVRFMQQWLETRGSPK 131

  Fly    73 SSIEKVEFSSQRERDRYGYANFHI 96
            |.|::..|::::......|::|.|
Mouse   132 SHIDRANFNNEKVIANLDYSDFQI 155

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 36/89 (40%)
Acyp1NP_001351289.1 Acylphosphatase 68..155 CDD:307036 34/86 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1502266at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10029
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.980

Return to query results.
Submit another query.