DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and CG34161

DIOPT Version :10

Sequence 1:NP_523563.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001097143.1 Gene:CG34161 / 5740441 FlyBaseID:FBgn0085190 Length:125 Species:Drosophila melanogaster


Alignment Length:96 Identity:46/96 - (47%)
Similarity:61/96 - (63%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATHNVHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLR 66
            |.:.:.||:|||||.||||.||:|..:||..||:.|||||:::|||:|.:||...:|..||.||:
  Fly    29 AQNQIFSCQFEVFGHVQGVFFRKHTQKKAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQ 93

  Fly    67 TTGSPLSSIEKVEFSSQRERDRYGYANFHIK 97
            ..|||.|.|||..||.........:..|.|:
  Fly    94 HKGSPRSVIEKAVFSENEPLPINNFKMFSIR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_523563.1 Acylphosphatase 9..96 CDD:425830 43/86 (50%)
CG34161NP_001097143.1 Acylphosphatase 36..123 CDD:425830 43/86 (50%)

Return to query results.
Submit another query.