DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and CG34161

DIOPT Version :8

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001097143.1 Gene:CG34161 / 5740441 FlyBaseID:FBgn0085190 Length:125 Species:Drosophila melanogaster

Alignment Length:96 Identity:46/97 (47%)
Similarity:61/97 (63%) Gaps:0/97 (0%)


  Fly     2 ATHNVHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLR 66
            |.:.:.||:|||||.||||.||:|..:||..||:.|||||:::|||:|.:||...:|..||.||:
  Fly    29 AQNQIFSCQFEVFGHVQGVFFRKHTQKKAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQ 93

  Fly    67 TTGSPLSSIEKVEFSSQRERDRYGYANFHIK 97
            ..|||.|.|||..||.........:..|.|:
  Fly    94 HKGSPRSVIEKAVFSENEPLPINNFKMFSIR 124

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 45/91 (49%)
CG34161NP_001097143.1 Acylphosphatase 35..124 CDD:279097 45/89 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131063146
eggNOG 1 0.900 E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5255
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1502266at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127552
Panther 1 1.100 P PTHR10029
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.