DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and Acyp2

DIOPT Version :8

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001262612.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster

Alignment Length:92 Identity:42/92 - (45%)
Similarity:58/92 - (63%) Gaps:0/92 - (0%)


  Fly     6 VHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGS 70
            :.:.:||:|||||||.||:|...:||.||:||||||:..|||||.:|.....:..||.||.....
  Fly    10 IFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRI 74

  Fly    71 PLSSIEKVEFSSQRERDRYGYANFHIK 97
            |.:.:.|.|||..:|.:.|.:.:|.||
  Fly    75 PNAKVSKAEFSQIQEIEDYTFTSFDIK 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 40/90 (44%)
Acyp2NP_001262612.1 Acylphosphatase 12..101 CDD:279097 40/88 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C131063329
eggNOG 1 0.900 E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5255
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1502266at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127552
Panther 1 1.100 P PTHR10029
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.