DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and CG14022

DIOPT Version :8

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001285625.1 Gene:CG14022 / 33763 FlyBaseID:FBgn0031700 Length:101 Species:Drosophila melanogaster

Alignment Length:88 Identity:33/88 - (37%)
Similarity:49/88 - (55%) Gaps:0/88 - (0%)


  Fly    10 EFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSS 74
            :|||:|.|||:|..:....:....|:.||..||.:||:.|.::|...|:|.|..||.|.|||...
  Fly    13 DFEVYGHVQGLNLTKDTRDRCTKAGITGWVKNSKQGTIVGKMQGPKEEVDKMITWLSTEGSPGCQ 77

  Fly    75 IEKVEFSSQRERDRYGYANFHIK 97
            |::.|..:|....|..|.:|.|:
  Fly    78 IDRCEVRNQGNLSRLDYKDFAIR 100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 32/86 (37%)
CG14022NP_001285625.1 Acylphosphatase 8..100 CDD:279097 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5759
OrthoDB 1 1.010 D1502266at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127552
Panther 1 1.100 P PTHR10029
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.