DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smg5 and Smg5

Sequence 1:NP_001285914.1 Gene:Smg5 FlyBaseID:FBgn0019890 Length:1177 Species:Drosophila melanogaster
Sequence 2:XP_001059906.3 Gene:Smg5 RGDID:1584731 Length:1017 Species:Rattus norvegicus

Alignment Length:1269 Identity:276/1270 (22%)
Similarity:452/1270 (36%) Gaps:413/1270 (33%)


  Fly    43 KDLYRSLYTASKQLDDAKRNVQSVGQLFQHEIEEKRSLLVQLCKQIIFKDYQSVGKKVREVMWRR 107
            |.|||::..|..:||....|..:..::|:.|....|:.|.:||.:::|......|:|..|::||:
  Rat    21 KRLYRAVVEAVHRLDLILCNKTAYQEVFKPENVSLRNKLRELCVKLMFLHPVDYGRKAEELLWRK 85

  Fly   108 GYYEFIAFVKKNWHKQCQDAATAQENMQKLERFLCAGIFNYKRLSARMEEIYDLDLKYLIDFSII 172
            .|||.|..:|.| .|.....:|.:   ......|.|||..|:.|...::..|.|:|:..||::.:
  Rat    86 VYYEVIQLIKTN-KKHIHSRSTLE---CAYRTHLVAGIGFYQHLLLYIQSHYQLELQCCIDWTHV 146

  Fly   173 SDGYISDMIGDTMESSHSGTHAVDKSLEAVSFALDTIHSSLLSLGDLHRYFLDFR-IDSKLSISK 236
            :|    .:||.....|.||        :.:.:|....|..|:.||||.||..:.. :|::|    
  Rat   147 TD----PLIGCKKPVSASG--------KEMDWAQMACHRCLVYLGDLSRYQNELAGVDTEL---- 195

  Fly   237 EQVAKYYLEAFKLNPAIGMAQNQLGTLHYGQNHDLDSTYHYLYSLVCIIPFELSENNLNKLF--- 298
             ...::|.:|..:.|.|||..||||||...:.:.:::.|.||..:...:.||.:..||.:|:   
  Rat   196 -LAERFYYQALSVAPQIGMPFNQLGTLAGSKYYSVEAMYCYLRCIQSEVSFEGAYGNLKRLYDKA 259

  Fly   299 AKHTEYLERMDPEKLD------FNIEDFFARFYLIVDIF-----FFDKEVPDFNALCHCVLIDLR 352
            ||....|::.:..||.      .:|:.....|..:..:.     ..|.|:   .:||..||.|..
  Rat   260 AKMYHQLKKSETRKLSPSKKRCKDIKRLLVNFMYLQSLLQPKSSSVDSEL---TSLCQSVLEDFN 321

  Fly   353 KILC---------------------SQQLRVPEPSIFKIVSILFFCLSKLKMINSPKVYSLHAFL 396
              ||                     |....:|:..||::..|....:..||...|.:..:..||.
  Rat   322 --LCLFYLPSSPSLGLTNEDEEECESGYAFLPDLLIFQMAIICLMGVHSLKRAGSKQYSAAIAFT 384

  Fly   397 VAACSDLMDACIVSIEQTILARAQDNERFQAEYEERFQEFDTVVRKSRNEYKNWLAAVGECERKD 461
            :|..|.|::              ..|.|.|||.||                       ||     
  Rat   385 LALFSHLIN--------------HVNIRLQAELEE-----------------------GE----- 407

  Fly   462 KKLMPRPHSLKDCSSDSRDSQHSGEEAKTQEAADGDKIGEAVSTRSSDEAKESDLKTPLSCKSKR 526
                   :.:....||..|...| :||..:|..:.:   .......:||.::|...:.|||    
  Rat   408 -------NPVSAFQSDGTDEPES-KEALEKEEPEPE---PPTVVPQADEGRKSRKHSRLSC---- 457

  Fly   527 RGMRLRRRRRKIAQSDDSSCYDSESELDTDFYSDEEDYTDLSSNFDTDFSDIDAADPGEPCGEER 591
              :|.|||.......|||                     |||..|::| |..|:|          
  Rat   458 --LRRRRRHHPPKAGDDS---------------------DLSEGFESD-SSHDSA---------- 488

  Fly   592 YAAANYSKKERKAGGGGGGGVGGVVYSDNEDVVIEEEKIVYPNEVERRSNSQEADSEELLRSFEV 656
                       :|..|...|         .|..:|.....:..|.:...||||:.|:  |...| 
  Rat   489 -----------QASDGSDSG---------SDKSLEGRGTAFDAETDSEMNSQESRSD--LEDIE- 530

  Fly   657 LQLNFKSAEDAQSKPVAPPPVSFSEPPKKL---------------------VYRNK--------Y 692
                   .|:....|...||.:.||.|..|                     :::.|        :
  Rat   531 -------DEEGTRSPAQEPPQTRSEVPDSLNGPLGPSEASIASNLQAMSTQMFQTKRCFRLAPTF 588

  Fly   693 TKI------NPNIV--------------------------------------------IDCLHNE 707
            :.:      .||.|                                            :..|..|
  Rat   589 SNLLLQPTAEPNSVASHRPCVNGDMEKPLEPASEDGSESEGSESSSRSCRNERSLQEKLQALMAE 653

  Fly   708 PTIRALKMLFDWLRINPEILIGCYHSNPEFVHKIMKLLNYCNIDIFTRKVYFERDLLTTANVRDS 772
            ..:.|:|:..||||.||:::|.|..|:....:::..|||.               |..:..::||
  Rat   654 GLLPAVKVFLDWLRTNPDLIIVCAQSSQSLWNRLSVLLNL---------------LPASGELQDS 703

  Fly   773 LV-------------ELFDVRANVPLTEDFAFKNFDIFQSTQITLDWETIIRERVTPQEESILRI 824
            .:             ||.|:.|::.|.||.|.:|....::.....:::. .|..::..|||::||
  Rat   704 GLALCSEVQGLLEGCELPDLPASLLLPEDMALRNLPPLRAAHRRFNFDA-DRPLLSALEESVVRI 767

  Fly   825 FKMVDFGFFICKQKKFNYRFCVKTRRFTETQKKKQREEKKGGGSRRRERRTAPKTNRTKRNEGRT 889
            ..:..||.|:.:                                                     
  Rat   768 CYIRSFGHFVAR----------------------------------------------------- 779

  Fly   890 RRYSDRKNGIVRKSYTSNEEKDTVEECRKMPRKGYLRNRNAEKAAAVITSATGTSVAGGTSASTT 954
                                           .:|.:...|.|....|            :.|.:.
  Rat   780 -------------------------------LQGSILQFNPEVGIFV------------SIAQSE 801

  Fly   955 TNSVIEKLNLQSSSGADEERSEAKSKKCELMGKLWLQNEVETLEEELRDSPAHVVMSPFVVVDSK 1019
            ..|::::...|.....:|.|   :::....|.:|.||.||..||..|:...|...|||:::.|::
  Rat   802 QESLLQQAQAQFRMAEEEAR---RNRLMRDMAQLRLQLEVSQLEGSLQQPKAQSAMSPYLIPDTQ 863

  Fly  1020 ALTEYNGIVKSLVRTKKCIVLIPNAVLNELDDLKKRSENVRHVIRWLEQEFKQGNRHLRAQRD-N 1083
            ||..:..:::.|..:.:.|::||..|::.||.|||.....|..||:||.|||:|||::|.|:: .
  Rat   864 ALCYHLPVIRQLATSGRFIIIIPRTVIDGLDLLKKEQPGARDGIRYLEAEFKKGNRYIRCQKEVG 928

  Fly  1084 ESQPLSLLKISRKMDRDASVFLQIAQFCNHLV----ANHADPHVSELQKSVVTYLSGDNLHEKNR 1144
            :|.....||   :.|.||....:|...|..|.    |...||      ..:||.::|  ||..|.
  Rat   929 KSFERHKLK---RQDADAWTLYKILDSCRQLTLAQGAGEEDP------SGMVTIITG--LHLDNP 982

  Fly  1145 QQQNFSYTGILD-----SIPVRYAQIQSFYAKFK 1173
            ...:......|.     |:.|:  .:..||.::|
  Rat   983 SALSGPMQAALQAAAHASVDVK--NVLDFYRQWK 1014

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smg5NP_001285914.1 EST1 99..222 CDD:287360 37/123 (30%)
EST1_DNA_bind 240..478 CDD:287359 60/273 (22%)
PIN_Smg5 1012..1173 CDD:189054 50/171 (29%)
Smg5XP_001059906.3 EST1 77..187 CDD:287360 30/110 (27%)
TPR repeat 172..206 CDD:276809 9/35 (26%)
EST1_DNA_bind 197..>411 CDD:287359 61/250 (24%)
TPR repeat 211..241 CDD:276809 11/30 (37%)
TPR repeat 246..268 CDD:276809 5/22 (23%)
PIN_Smg5 856..1014 CDD:189054 26/158 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C319807272
eggNOG 1 0.900 E1_KOG2162
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4491
OMA 1 1.010
OrthoDB 1 1.010 D102776at33208
OrthoFinder 1 1.000 FOG0006233
OrthoInspector 1 1.000 T1087236
orthoMCL 1 0.900 OOG5_134395
Panther 1 1.100 LDO PTHR15696
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.