DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Smg5 and Smg7

Sequence 1:NP_001285914.1 Gene:Smg5 FlyBaseID:FBgn0019890 Length:1177 Species:Drosophila melanogaster
Sequence 2:XP_006250067.1 Gene:Smg7 RGDID:1310761 Length:1212 Species:Rattus norvegicus

Alignment Length:650 Identity:130/650 (20%)
Similarity:217/650 (33%) Gaps:204/650 (31%)


  Fly    73 EIEEKRSLLVQLCKQIIFKDYQ-SVGKKVREVMWRRGYYEFIAFVKKNWHKQCQDAATAQENMQK 136
            |:...|..|..|.::::..|.: ::.|||.:.:|...:        ||.....|..|..:.|..:
  Rat    53 EVWTSRQALQDLYQKMLVTDLEYALDKKVEQDLWNHAF--------KNQITTLQGQAKNRANPNR 109

  Fly   137 ------LERFLCAGIFNYKRLSARMEEIYDLDLKYLIDFSIISDGYISDMIGDTMESSHSGTHAV 195
                  |..||.|....|.:|...:..::::||...:..|.:  |.||:      :.:|  |.|:
  Rat   110 SEVQANLSLFLEAASGFYTQLLQELCTVFNVDLPCRVKSSQL--GIISN------KQTH--TSAI 164

  Fly   196 DKSLEAVSFALDTIHSSLLSLGDLHRYFLDFRIDSKLSISKEQVAKYYLEAFKLNPAIGMAQNQL 260
            .|. ::.|.:....| .|:.|||:.||          .....|...||..|.:|.|:.|...|||
  Rat   165 VKP-QSSSCSYICQH-CLVHLGDIARY----------RNQTSQAESYYRHAAQLVPSNGQPYNQL 217

  Fly   261 GTLHYGQNHDLDSTYHYLYSLVCIIPFELSENNLNKLFAKHTEYLERMDPEKLDFNIEDFFARFY 325
            ..|...:...|.:.::|..|:....||..:..||.|..:|   .||..|..|..:.:.||...|.
  Rat   218 AILASSKGDHLTTIFYYCRSIAVKFPFPAASTNLQKALSK---ALESRDELKTKWGVSDFIKAFI 279

  Fly   326 LIVDIFFFDKEVPDFNALCHCVLIDLRKILCSQQLRVPEPSIFKIVSILFFCLSKLKMINSPKVY 390
            ......:..|.:..        |..||:.|..|         ||  .:||     .|..||    
  Rat   280 KFHGHVYLSKSLEK--------LSPLREKLEEQ---------FK--RLLF-----QKAFNS---- 316

  Fly   391 SLHAFLVAACSDLMDACIVSIEQTILARAQDNERFQAEYEE-----------RFQEFDTVV---- 440
                      ..|:...::::.|....|...||..|..|.:           .|..|..::    
  Rat   317 ----------QQLVHVTVINLFQLHHLRDFSNETEQHSYSQDEQLCWTQLLALFMSFLGILCKCP 371

  Fly   441 -----RKSRNEY--------KNWLAAVGECERKDKKLMPRPHSLKDCSSDSR-----------DS 481
                 ::|.|.|        .:||..             ||...::...|.|           :|
  Rat   372 LQNDSQESYNAYPLPAVKVSMDWLRL-------------RPRVFQEAVVDERQYIWPWLISLLNS 423

  Fly   482 QHSGEEAKTQEAADGDKIGEAVSTRSSDEAKESDLKTPLSCKSKRRGM----------------- 529
            .|..|:             :..||.::...:|.:|:..|:.:...|.:                 
  Rat   424 FHPRED-------------DLSSTNATPLPEEFELQGFLALRPSFRNLDFSKGHQGITGDKEGQQ 475

  Fly   530 -RLRRRR-----RKIAQSDDS--SCYDSESELDTDFYSDEEDYTDLSSNFDTDFSDIDAADPGEP 586
             |:|::|     :.||.:...  .|.:...:|                .|.|:..::...||.| 
  Rat   476 RRIRQQRLISIGKWIADNQPRLIQCENEVGKL----------------LFITEIPELILEDPSE- 523

  Fly   587 CGEERYAAANYSKKERKA----GGGGGGGVGGVVYS---------DNEDVVIEEEKIVYPNEVER 638
                  |..|...:|..|    ...|..|:..|:.:         ..|..|:..::.:.|.||.|
  Rat   524 ------AKENLILQETSAIESHASDGSPGLKSVLSTGRSPSTSCDSGEKPVVTFKENIKPREVNR 582

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Smg5NP_001285914.1 EST1 99..222 CDD:287360 31/129 (24%)
EST1_DNA_bind 240..478 CDD:287359 56/266 (21%)
PIN_Smg5 1012..1173 CDD:189054
Smg7XP_006250067.1 EST1 80..192 CDD:287360 32/142 (23%)
TPR repeat 179..205 CDD:276809 10/36 (28%)
EST1_DNA_bind 196..455 CDD:287359 65/326 (20%)
TPR repeat 210..240 CDD:276809 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D102776at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.