DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7968 and CG7916

Sequence 1:NP_609684.1 Gene:CG7968 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_609682.1 Gene:CG7916 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster

Alignment Length:269 Identity:70/270 (26%)
Similarity:101/270 (37%) Gaps:49/270 (18%)


  Fly     1 MRTSCVIFVALLCCSLGSAKLFDDELRELTE------------------------------FLRL 35
            |:....:||.||.|    ...:|.||  |||                              .|..
  Fly     1 MKAIVCVFVTLLAC----VAAYDVEL--LTEEQWDQLVARNPAKPDTQGLILNGSVKKAINGLLN 59

  Fly    36 QMRCGYPARGVPILAPAQMAYKEIGIRTENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHT---- 96
            ||.||:|..|:|.|.|...|...|.:..........|.....:||:|.|..|::   :.:|    
  Fly    60 QMPCGWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMK---VSYTFSKK 121

  Fly    97 IKFDMNFPKISLKS----TNYKLNLLARLFGADFSLWGDGALSLELINFRAYGSFVIRPKSATSG 157
            :||..|||::...:    ||..:|||..| |........|.||..|.|....|.|..:.......
  Fly   122 VKFHFNFPELKASAHYLDTNTFVNLLKEL-GLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGS 185

  Fly   158 VYAKSWKVNWELEEAKSQTTGFMNSRLYTKFINDLIVEYLDIMINDNPTEVSQFMEELIVPPMNL 222
            :....:.....|....|...|.|.:....:||||::.:.:...||.|..::|..:||:.||..|.
  Fly   186 IKIYKFSCAVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANA 250

  Fly   223 VL-DNLAWY 230
            .| .:..||
  Fly   251 HLTGHKIWY 259

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7968NP_609684.1 JHBP 5..234 CDD:214779 69/266 (26%)
CG7916NP_609682.1 JHBP 33..262 CDD:214779 58/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134653642
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20993
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.