DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7968 and CG33306

Sequence 1:NP_609684.1 Gene:CG7968 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster

Alignment Length:247 Identity:55/248 (22%)
Similarity:112/248 (45%) Gaps:28/248 (11%)


  Fly     7 IFVALLCCS--------LGSAKLFDDELRELTEFLRLQMRCGYPARGVPILAPAQMAYKEIGIRT 63
            :.|||..|.        ....:.|...:.:..|..|:.::.|.|..|:|::||.:.|.:...|.:
  Fly     9 LIVALASCQGAEVAEPLSAQGRSFSSVIVDGLEAFRVVLQNGSPRFGIPVMAPMKAAQRSFEINS 73

  Fly    64 ENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHTIKFDMNFPKISLKSTNYKLNLLARLFGADFSL 128
            ..|.......:..::|||.||...:..:.|...:.|::||..::. :|:|::::     |:.:.:
  Fly    74 GEFSGTFGVENFELQGLDQYEIITMNMDVIRSRLTFNINFASLNF-TTDYEMDM-----GSGYRI 132

  Fly   129 WGDGA--LSLELINFRAYGSFVIRPKSATSGVYAKSWKVNWEL-----EEAKSQTTGFMNSRLYT 186
            ..:|.  .:||.:|.:...|:.:       ||:....:|...|     ....||.......|::.
  Fly   133 KRNGGAFFALEDLNIQGRISYSL-------GVFTSQLRVKDVLIYPSVGNVNSQIENLSKYRIFN 190

  Fly   187 KFINDLIVEYLDIMINDNPTEVSQFMEELIVPPMNLVLDNLAWYEITAIILG 238
            :.:|::|.|::.:.||:|...|:.::.|...|..|.::.:....:|.|||.|
  Fly   191 RKLNEIIEEFVTLTINENTDFVAAWVSEQATPICNDLIGDRTLSDIIAIITG 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7968NP_609684.1 JHBP 5..234 CDD:214779 51/242 (21%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 47/227 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134653538
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20993
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.