DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7968 and CG33306

DIOPT Version :9

Sequence 1:NP_609684.1 Gene:CG7968 / 34802 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 / 2768915 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster


Alignment Length:247 Identity:55/247 - (22%)
Similarity:112/247 - (45%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFVALLCCS--------LGSAKLFDDELRELTEFLRLQMRCGYPARGVPILAPAQMAYKEIGIRT 63
            :.|||..|.        ....:.|...:.:..|..|:.::.|.|..|:|::||.:.|.:...|.:
  Fly     9 LIVALASCQGAEVAEPLSAQGRSFSSVIVDGLEAFRVVLQNGSPRFGIPVMAPMKAAQRSFEINS 73

  Fly    64 ENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHTIKFDMNFPKISLKSTNYKLNLLARLFGADFSL 128
            ..|.......:..::|||.||...:..:.|...:.|::||..::. :|:|::::     |:.:.:
  Fly    74 GEFSGTFGVENFELQGLDQYEIITMNMDVIRSRLTFNINFASLNF-TTDYEMDM-----GSGYRI 132

  Fly   129 WGDGA--LSLELINFRAYGSFVIRPKSATSGVYAKSWKVNWEL-----EEAKSQTTGFMNSRLYT 186
            ..:|.  .:||.:|.:...|:.:       ||:....:|...|     ....||.......|::.
  Fly   133 KRNGGAFFALEDLNIQGRISYSL-------GVFTSQLRVKDVLIYPSVGNVNSQIENLSKYRIFN 190

  Fly   187 KFINDLIVEYLDIMINDNPTEVSQFMEELIVPPMNLVLDNLAWYEITAIILG 238
            :.:|::|.|::.:.||:|...|:.::.|...|..|.::.:....:|.|||.|
  Fly   191 RKLNEIIEEFVTLTINENTDFVAAWVSEQATPICNDLIGDRTLSDIIAIITG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7968NP_609684.1 JHBP 5..234 CDD:214779 51/241 (21%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 47/226 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458089
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.