DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7916 and CG7968

DIOPT Version :9

Sequence 1:NP_609682.1 Gene:CG7916 / 34800 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609684.1 Gene:CG7968 / 34802 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster


Alignment Length:269 Identity:70/269 - (26%)
Similarity:101/269 - (37%) Gaps:49/269 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAIVCVFVTLLAC----VAAYDVEL--LTEEQWDQLVARNPAKPDTQGLILNGSVKKAINGLLN 59
            |:....:||.||.|    ...:|.||  |||                              .|..
  Fly     1 MRTSCVIFVALLCCSLGSAKLFDDELRELTE------------------------------FLRL 35

  Fly    60 QMPCGWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMK---VSYTFSKK 121
            ||.||:|..|:|.|.|...|...|.:..........|.....:||:|.|..|::   :.:|    
  Fly    36 QMRCGYPARGVPILAPAQMAYKEIGIRTENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHT---- 96

  Fly   122 VKFHFNFPELKASAHYLDTNTFVNLLKEL-GLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGS 185
            :||..|||::...:    ||..:|||..| |........|.||..|.|....|.|..:.......
  Fly    97 IKFDMNFPKISLKS----TNYKLNLLARLFGADFSLWGDGALSLELINFRAYGSFVIRPKSATSG 157

  Fly   186 IKIYKFSCAVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANA 250
            :....:.....|....|...|.|.:....:||||::.:.:...||.|..::|..:||:.||..|.
  Fly   158 VYAKSWKVNWELEEAKSQTTGFMNSRLYTKFINDLIVEYLDIMINDNPTEVSQFMEELIVPPMNL 222

  Fly   251 HLTGHKIWY 259
            .| .:..||
  Fly   223 VL-DNLAWY 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7916NP_609682.1 JHBP 33..262 CDD:214779 58/231 (25%)
CG7968NP_609684.1 JHBP 5..234 CDD:214779 69/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.