DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7916 and CG7968

Sequence 1:NP_609682.1 Gene:CG7916 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_609684.1 Gene:CG7968 FlyBaseID:FBgn0028532 Length:250 Species:Drosophila melanogaster

Alignment Length:269 Identity:70/270 (26%)
Similarity:101/270 (37%) Gaps:49/270 (18%)


  Fly     1 MKAIVCVFVTLLAC----VAAYDVEL--LTEEQWDQLVARNPAKPDTQGLILNGSVKKAINGLLN 59
            |:....:||.||.|    ...:|.||  |||                              .|..
  Fly     1 MRTSCVIFVALLCCSLGSAKLFDDELRELTE------------------------------FLRL 35

  Fly    60 QMPCGWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMK---VSYTFSKK 121
            ||.||:|..|:|.|.|...|...|.:..........|.....:||:|.|..|::   :.:|    
  Fly    36 QMRCGYPARGVPILAPAQMAYKEIGIRTENFGCNGNFTDLIIEGLDGYEFSKLEWNNILHT---- 96

  Fly   122 VKFHFNFPELKASAHYLDTNTFVNLLKEL-GLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGS 185
            :||..|||::...:    ||..:|||..| |........|.||..|.|....|.|..:.......
  Fly    97 IKFDMNFPKISLKS----TNYKLNLLARLFGADFSLWGDGALSLELINFRAYGSFVIRPKSATSG 157

  Fly   186 IKIYKFSCAVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANA 250
            :....:.....|....|...|.|.:....:||||::.:.:...||.|..::|..:||:.||..|.
  Fly   158 VYAKSWKVNWELEEAKSQTTGFMNSRLYTKFINDLIVEYLDIMINDNPTEVSQFMEELIVPPMNL 222

  Fly   251 HLTGHKIWY 259
            .| .:..||
  Fly   223 VL-DNLAWY 230

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7916NP_609682.1 JHBP 33..262 CDD:214779 58/232 (25%)
CG7968NP_609684.1 JHBP 5..234 CDD:214779 69/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134653642
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20993
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.