DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7916 and CG7953

Sequence 1:NP_609682.1 Gene:CG7916 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001285913.1 Gene:CG7953 FlyBaseID:FBgn0028533 Length:297 Species:Drosophila melanogaster

Alignment Length:303 Identity:103/304 (34%)
Similarity:147/304 (48%) Gaps:41/304 (13%)


  Fly     8 FVTLLACVAAY----------------------DVELLTEEQWDQLVARNPAKPDTQGLILNGSV 50
            |:.:|||:.|.                      |::|:.|.|....||..        .|::...
  Fly     3 FLVVLACLVAVCAAGTLPNEVEQRLLELADQNGDIDLVAEPQEGVEVAPQ--------FIVSWQA 59

  Fly    51 KKAINGLLNQMPCGWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMKVS 115
            ::.|..|..||.|||||||||.|.|....:..:...:.:.:||....|.:..||....|:|.|::
  Fly    60 RRFIRKLQKQMECGWPQYGIPVLAPLRINEFDLDYKKGIFETLNHVFRLKIAGLNDFNIQKFKLN 124

  Fly   116 YTFSKKVKFHFNFPELKASAHYLDTNTFVNLLKELGLSVRYESSGPLSFSLQNLSIQGEFKYKMP 180
             ..:.|:.|.|.|..:..:|...||:|.::.|::|||||.||.||.|.|.|.||.|.|..|||:|
  Fly   125 -VITSKITFDFLFKNIDTTAQKYDTDTLIDALRQLGLSVEYEGSGELLFDLVNLRIAGTLKYKLP 188

  Fly   181 FIFGSIKIYKFSCAVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFV 245
            .::||.||......:.|..|:|:|.|.||||:||..||..|:..:...|||||:.||..||...|
  Fly   189 MLWGSAKITSLKTTISLESVTSDITGFMGNGKINRAINSQLENIVVKGINGNQDAISETIENAIV 253

  Fly   246 PLANAHLTGHKIWYLFSLLSATTG----------SCNPTPAPW 278
            |..|..|.|...|.:..|:.|::.          .|:|:..||
  Fly   254 PRVNKMLKGKDFWTVVDLILASSDGESEDDPIVVDCDPSADPW 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7916NP_609682.1 JHBP 33..262 CDD:214779 87/229 (38%)
CG7953NP_001285913.1 JHBP 44..268 CDD:214779 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134653557
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20993
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.