DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7916 and CG8997

Sequence 1:NP_609682.1 Gene:CG7916 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001285912.1 Gene:CG8997 FlyBaseID:FBgn0028920 Length:260 Species:Drosophila melanogaster

Alignment Length:287 Identity:82/288 (28%)
Similarity:134/288 (47%) Gaps:44/288 (15%)


  Fly     7 VFVTLLACVAAYDVELLTEEQWDQLVARNPAKP-DTQGLILNGSVKKAINGLLNQMPCGWPQYGI 70
            :||.:||.||...             |.:..:| :||.  ::.::...|.|:..|||||:...|:
  Fly     3 IFVAILAFVAVAS-------------AASMGQPIETQS--ISSTIVDVIEGIKEQMPCGFTSVGL 52

  Fly    71 PPLDPY------TNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMKVSYTFSKKVKFHFNFP 129
            |||.|.      .|.|..:..|:..:|      .||.:||...:|.:|||: ..:.||.:.|.|.
  Fly    53 PPLAPLRIDHQDINIDSSVLKAQGTID------HFRLNGLNDFDIDEMKVN-AITSKVTYKFTFR 110

  Fly   130 ELKASAHYLDTNTFVNLLKELGLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGSIKIYKFSCA 194
            ::.....| |.:.   |||:.|.::....:|...|:::::.|.|..||.:..|.|::|:......
  Fly   111 DVNVDTQY-DLSV---LLKKYGFTINLIGAGHAKFAIKDMVIWGTMKYSLGVISGNLKLKSLEVR 171

  Fly   195 VGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANAHLTGHKIWY 259
            ..||.|.|.|.|::|:|.|||.:|:.|.:.:...||.|::.|:..||.|.:|..|:.|....|  
  Fly   172 THLGEVDSEIEGILGDGSINEKMNEYLAEAVELAINENEDLIADTIESIALPAVNSVLDDISI-- 234

  Fly   260 LFSLLSATTG--------SCNPTPAPW 278
             ..::|...|        :|.|....|
  Fly   235 -AEIISGAGGDGEGGEKEACIPPEFEW 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7916NP_609682.1 JHBP 33..262 CDD:214779 71/236 (30%)
CG8997NP_001285912.1 JHBP 21..239 CDD:214779 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134653600
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20993
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.