DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7916 and CG33306

DIOPT Version :9

Sequence 1:NP_609682.1 Gene:CG7916 / 34800 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 / 2768915 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster


Alignment Length:271 Identity:56/271 - (20%)
Similarity:107/271 - (39%) Gaps:31/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKA--IVCVFVTLLACVAAYDVELLTEEQWDQLVARNPAKPDTQGLILNGSVKKAINGLLNQMPC 63
            ||:  ::.:.|.|.:|..|...|.|:                .||...:..:...:......:..
  Fly     1 MKSAFLIALIVALASCQGAEVAEPLS----------------AQGRSFSSVIVDGLEAFRVVLQN 49

  Fly    64 GWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMKVSYTFSKKVKFHFNF 128
            |.|::|||.:.|...|.....:.............|...||:..||..|.:. ....::.|:.||
  Fly    50 GSPRFGIPVMAPMKAAQRSFEINSGEFSGTFGVENFELQGLDQYEIITMNMD-VIRSRLTFNINF 113

  Fly   129 PELKASAHYLDTNTFVNLLKELGLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGSIKIYKFSC 193
            ..|..:..|         ..::|...|.:.:|...|:|::|:|||...|.:......:::.....
  Fly   114 ASLNFTTDY---------EMDMGSGYRIKRNGGAFFALEDLNIQGRISYSLGVFTSQLRVKDVLI 169

  Fly   194 AVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANAHLTGHKIW 258
            ...:|.|:|.|..:......|..:|:::::.:...||.|.:.::|.:.|...|:.| .|.|.:. 
  Fly   170 YPSVGNVNSQIENLSKYRIFNRKLNEIIEEFVTLTINENTDFVAAWVSEQATPICN-DLIGDRT- 232

  Fly   259 YLFSLLSATTG 269
             |..:::..||
  Fly   233 -LSDIIAIITG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7916NP_609682.1 JHBP 33..262 CDD:214779 46/228 (20%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 48/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D127466at33392
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20993
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.