DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7916 and CG33306

Sequence 1:NP_609682.1 Gene:CG7916 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster

Alignment Length:271 Identity:56/272 (21%)
Similarity:107/272 (39%) Gaps:31/272 (11%)


  Fly     1 MKA--IVCVFVTLLACVAAYDVELLTEEQWDQLVARNPAKPDTQGLILNGSVKKAINGLLNQMPC 63
            ||:  ::.:.|.|.:|..|...|.|:                .||...:..:...:......:..
  Fly     1 MKSAFLIALIVALASCQGAEVAEPLS----------------AQGRSFSSVIVDGLEAFRVVLQN 49

  Fly    64 GWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMKVSYTFSKKVKFHFNF 128
            |.|::|||.:.|...|.....:.............|...||:..||..|.:. ....::.|:.||
  Fly    50 GSPRFGIPVMAPMKAAQRSFEINSGEFSGTFGVENFELQGLDQYEIITMNMD-VIRSRLTFNINF 113

  Fly   129 PELKASAHYLDTNTFVNLLKELGLSVRYESSGPLSFSLQNLSIQGEFKYKMPFIFGSIKIYKFSC 193
            ..|..:..|         ..::|...|.:.:|...|:|::|:|||...|.:......:::.....
  Fly   114 ASLNFTTDY---------EMDMGSGYRIKRNGGAFFALEDLNIQGRISYSLGVFTSQLRVKDVLI 169

  Fly   194 AVGLGGVSSNIGGVMGNGRINEFINDMLDKEIPAFINGNQEQISAKIEEIFVPLANAHLTGHKIW 258
            ...:|.|:|.|..:......|..:|:::::.:...||.|.:.::|.:.|...|:.| .|.|.:. 
  Fly   170 YPSVGNVNSQIENLSKYRIFNRKLNEIIEEFVTLTINENTDFVAAWVSEQATPICN-DLIGDRT- 232

  Fly   259 YLFSLLSATTG 269
             |..:::..||
  Fly   233 -LSDIIAIITG 242

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7916NP_609682.1 JHBP 33..262 CDD:214779 46/229 (20%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 49/241 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134653654
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20993
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.