DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7916 and CG33307

Sequence 1:NP_609682.1 Gene:CG7916 FlyBaseID:FBgn0028534 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001285911.1 Gene:CG33307 FlyBaseID:FBgn0053307 Length:170 Species:Drosophila melanogaster

Alignment Length:223 Identity:46/224 (21%)
Similarity:75/224 (33%) Gaps:75/224 (33%)


  Fly     1 MKAIVCVFVTLLACVAA--YDVELLTEEQWDQLVARNPAKPDTQGLILN---------GSVKKAI 54
            :|.|..:.|..|..|||  .:.:||..:...|......||.:|..|:.:         ..||.|:
  Fly     2 LKYIPLLLVAQLLIVAAKPTNPQLLNSDDPVQRELERQAKEETVHLLNSLFRSQIAYFSEVKAAL 66

  Fly    55 NGLLNQMPCGWPQYGIPPLDPYTNADLRIHLAESVVDTLLQFLRFRFDGLEGMEIKKMKVSYTFS 119
            |               |....:.:..|.|......:|                       .....
  Fly    67 N---------------PQTKRFQDISLYITRLSQAID-----------------------EQELD 93

  Fly   120 KKVKFHFN-FPELKASAHYLDTNTFVNLLKELGLS-VRYES--SGPLSFSLQNLSIQ-----GEF 175
            :|.:...| |.|.|      |:...:|...|.||: ::|::  :|.   .|||:|.:     .::
  Fly    94 RKDELWQNIFEEFK------DSPLLINRQSETGLTDLQYKTLLTGQ---KLQNISTKFVSDVADY 149

  Fly   176 KYKMPFIFGSIKIYKFSCAVGLGGVSSN 203
            .::|..|.|.:        ||.|..|.|
  Fly   150 FWEMAKISGKV--------VGNGIASQN 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7916NP_609682.1 JHBP 33..262 CDD:214779 36/190 (19%)
CG33307NP_001285911.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20993
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.