DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16890 and CG9452

DIOPT Version :8

Sequence 1:NP_609671.1 Gene:CG16890 / 34781 FlyBaseID:FBgn0028932 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649119.2 Gene:CG9452 / 40119 FlyBaseID:FBgn0036877 Length:422 Species:Drosophila melanogaster

Alignment Length:53 Identity:14/53 - (26%)
Similarity:22/53 - (41%) Gaps:9/53 - (16%)


  Fly    50 NHRFLWE-----DDELDSDTLSWEQRLALRYYRKL---FKE-YCIADLSRYKE 93
            |....|:     .:.||.|:|...:....||:..|   ||. ..||:...|::
  Fly   162 NKHLNWQPIPIVSEPLDEDSLLLVRTPCPRYFEALEEVFKRPEVIAETEPYEQ 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16890NP_609671.1 Fra10Ac1 42..156 CDD:286768 14/53 (26%)
CG9452NP_649119.2 HP_HAP_like 61..361 CDD:132717 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C84006794
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11567
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.