powered by:
Protein Alignment CG16890 and CG9452
DIOPT Version :9
| Sequence 1: | NP_609671.1 |
Gene: | CG16890 / 34781 |
FlyBaseID: | FBgn0028932 |
Length: | 258 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_649119.2 |
Gene: | CG9452 / 40119 |
FlyBaseID: | FBgn0036877 |
Length: | 422 |
Species: | Drosophila melanogaster |
| Alignment Length: | 53 |
Identity: | 14/53 - (26%) |
| Similarity: | 22/53 - (41%) |
Gaps: | 9/53 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 50 NHRFLWE-----DDELDSDTLSWEQRLALRYYRKL---FKE-YCIADLSRYKE 93
|....|: .:.||.|:|...:....||:..| ||. ..||:...|::
Fly 162 NKHLNWQPIPIVSEPLDEDSLLLVRTPCPRYFEALEEVFKRPEVIAETEPYEQ 214
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45462394 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR11567 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.