DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16890 and FRA10AC1

DIOPT Version :8

Sequence 1:NP_609671.1 Gene:CG16890 / 34781 FlyBaseID:FBgn0028932 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001334641.1 Gene:FRA10AC1 / 118924 HGNCID:1162 Length:315 Species:Homo sapiens

Alignment Length:260 Identity:106/261 (41%)
Similarity:164/261 (63%) Gaps:34/261 (13%)


  Fly    14 LSAKERHNYILSNYVLNLPNETE-----SRRHKRDIDVIRENHRFLW-EDDELDSDTLSWEQRLA 72
            :.|.:||...:::|:|....:.|     ....|.|:||||||||||| |:||:|   ::||:|||
Human    71 MDAYQRHTKFVNDYILYYGGKKEDFKRLGENDKTDLDVIRENHRFLWNEEDEMD---MTWEKRLA 132

  Fly    73 LRYYRKLFKEYCIADLSRYKENKIALRWRTEQEVVTGTGQFQCGSRHCGERDNLRSWEVNFRYIE 137
            .:||.||||||||||||:|||||...|||.|:||::|.|||.||:::|.:::.|:||||||.|||
Human   133 KKYYDKLFKEYCIADLSKYKENKFGFRWRVEKEVISGKGQFFCGNKYCDKKEGLKSWEVNFGYIE 197

  Fly   138 KGEPLNALVKVRLCPTHTDQLNYRTKKRECKKRRRREKEERRAEK---KRKR--------RKLDV 191
            .||..|||||:|||...:.:||:..:::|.|.::|::|.::..|:   |:.|        :|.|.
Human   198 HGEKRNALVKLRLCQECSIKLNFHHRRKEIKSKKRKDKTKKDCEESSHKKSRLSSAEEASKKKDK 262

  Fly   192 GHESSGEEEEEPVEPASESHPEASKEPTDSKDATTADEQIWQQQPDISREQASREQEFERYLEDL 256
            ||.||.:.|:..:..:.|             :.:.::.::| :.|....::.|:|:||:.|.:||
Human   263 GHSSSKKSEDSLLRNSDE-------------EESASESELW-KGPLPETDEKSQEEEFDEYFQDL 313

  Fly   257  256
            Human   314  313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16890NP_609671.1 Fra10Ac1 42..156 CDD:286768 73/115 (63%)
FRA10AC1NP_001334641.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C238650520
eggNOG 1 0.900 E1_KOG1297
Hieranoid 1 1.000
Homologene 1 1.000 H13852
Inparanoid 1 1.050 206 1.000 Inparanoid score I3663
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1444601at2759
OrthoFinder 1 1.000 FOG0006028
OrthoInspector 1 1.000 T1073568
orthoMCL 1 0.900 OOG5_130661
Panther 1 1.100 LDO PTHR11567
Phylome 1 0.910 0.909 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3026
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.