DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9014 and Rnf41

Sequence 1:NP_001285905.1 Gene:CG9014 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001157709.1 Gene:Rnf41 MGIID:1914838 Length:317 Species:Mus musculus

Alignment Length:321 Identity:141/322 (44%)
Similarity:214/322 (66%) Gaps:4/322 (1%)


  Fly     1 MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHL 65
            ||:|:....|.|||:||||||:.|||||||:..||||||.|||.:|..|:|.||||||.:..:||
Mouse     1 MGYDVTRFQGDVDEDLICPICSGVLEEPVQAPHCEHAFCNACITQWFSQQQTCPVDRSVVTVAHL 65

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMS 130
            .||.|:||||||:|:|.|..:..||:.::.|:...:|::.||||||..|.|.:|||:::||||:.
Mouse    66 RPVPRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDCEHNPKRPVTCEQGCGLEMPKDELP 130

  Fly   131 RHNCVFELRELVEKLAKEVSDLKQKQSDMEEQSSSQRREMELFQYYIAALRSTNPMLRNIGEQLD 195
            .|||:..||.:|::....:::|::..::.:.|.:.|:|:::|.:.|:.|:||.||.|:|:.|.::
Mouse   131 NHNCIKHLRSVVQQQQSRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQNLEETIE 195

  Fly   196 RFSLMQWGHGLPLANIHTWGSLISTPDNPMHLMVRDVLRESGCPMHMLNMLVERCHEDRWPEGLM 260
            ...:::|.:.|..|.:..||.:|||||..:..:::..|.|||||..::|.|:|..||..||:||.
Mouse   196 YNEILEWVNSLQPARVTRWGGMISTPDAVLQAVIKRSLVESGCPASIVNELIENAHERSWPQGLA 260

  Fly   261 TLDDRRENQHLMSRYVTRLVPGLVIGKPCVVVLGGENTHMPENLRPILGLVMIFVDGVNEV 321
            ||:.|:.|:.....||.:.:|    ||..|||:..||.||.:::....||||||..||.|:
Mouse   261 TLETRQMNRRYYENYVAKRIP----GKQAVVVMACENQHMGDDMVQEPGLVMIFAHGVEEI 317

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 25/37 (68%)
USP8_interact 137..319 CDD:286082 66/182 (36%)
Rnf41NP_001157709.1 RING 18..55 CDD:238093 25/37 (68%)
USP8_interact 137..315 CDD:286082 66/182 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D918518at2759
OrthoFinder 1 1.000 FOG0001632
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15315
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.