DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9014 and rnf41l

Sequence 1:NP_001285905.1 Gene:CG9014 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_002664951.1 Gene:rnf41l ZFINID:ZDB-GENE-030131-9441 Length:292 Species:Danio rerio

Alignment Length:199 Identity:73/200 (37%)
Similarity:107/200 (54%) Gaps:33/200 (17%)


  Fly     1 MGFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHL 65
            ||:||...||:|:|.|:|.:|.||||:|:| :.||||||..||..|:|....||.||..|..:||
Zfish     1 MGYDLERFVGYVNEGLLCCVCRDVLEDPLQ-APCEHAFCSTCIHGWLIHHNSCPEDRLPLDITHL 64

  Fly    66 VPVSRLMRNMLSRLKIKCTFSQSGCAQMLALE----------------------------EFRTH 102
            .|:.|.|||.|:||:::|.|...||..:.|||                            ....|
Zfish    65 RPLFRYMRNDLARLQVRCVFRPQGCEVICALESIHRHEQQCDYALLNCTNTGCPVQVSRRSLEAH 129

  Fly   103 VAACEHNPKVVVECSKGCGMKVPKDEMSRHNCVFELRELVEKLAKEVS-DLKQKQSDMEEQSSSQ 166
            :..||::.:|   |:.|||..:...:.::||||.|||..::.|..|:. .:::.:.:||.:..||
Zfish   130 LCVCEYSSRV---CASGCGYTILNTDEAQHNCVSELRAELDMLRAELDCKVEEVRHEMESRLDSQ 191

  Fly   167 RREM 170
            ||.|
Zfish   192 RRHM 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 20/37 (54%)
USP8_interact 137..319 CDD:286082 12/36 (33%)
rnf41lXP_002664951.1 zf-RING_2 18..53 CDD:290367 19/36 (53%)
Sina 82..>130 CDD:302762 8/48 (17%)
DUF1640 150..>234 CDD:285090 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32028588
eggNOG 1 0.900 E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D918518at2759
OrthoFinder 1 1.000 FOG0001632
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.