| Sequence 1: | NP_001285905.1 | Gene: | CG9014 / 34777 | FlyBaseID: | FBgn0028847 | Length: | 328 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001343919.2 | Gene: | rnf151 / 100004674 | ZFINID: | ZDB-GENE-121214-234 | Length: | 243 | Species: | Danio rerio | 
| Alignment Length: | 200 | Identity: | 51/200 - (25%) | 
|---|---|---|---|
| Similarity: | 95/200 - (47%) | Gaps: | 31/200 - (15%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLV 66 
  Fly    67 PVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVE---------------- 115 
  Fly   116 ---------CSKGCGMKVPKDEMSRHNCVFEL--RELVEKLAKE--VSDLKQKQSDMEEQSSSQR 167 
  Fly   168 REMEL 172 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG9014 | NP_001285905.1 | zf-C3HC4 | 18..55 | CDD:278524 | 16/36 (44%) | 
| USP8_interact | 137..319 | CDD:286082 | 9/39 (23%) | ||
| rnf151 | XP_001343919.2 | RING_Ubox | 20..58 | CDD:327409 | 17/38 (45%) | 
| zf-TRAF | 102..157 | CDD:280357 | 6/54 (11%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170594955 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0297 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D918518at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR15315 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 5 | 4.850 | |||||