DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG9014 and rnf151

Sequence 1:NP_001285905.1 Gene:CG9014 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_001343919.2 Gene:rnf151 ZFINID:ZDB-GENE-121214-234 Length:243 Species:Danio rerio

Alignment Length:200 Identity:51/200 (26%)
Similarity:95/200 (48%) Gaps:31/200 (16%)


  Fly     2 GFDLNCIVGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQICPVDRSGLLTSHLV 66
            |::::..|...|::|||.||..||..||: .:|.|.||:.||.:||.::..||..|..:..:.::
Zfish     4 GYEVDQFVDPPDDDLICVICRAVLRCPVR-LKCNHVFCKECILQWMKRQVKCPCCRQSIDQNQML 67

  Fly    67 PVSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVE---------------- 115
            .:.:|.:: :.||.:||...|.||.....|.....|::.|.:..::...                
Zfish    68 VLFKLSKS-IGRLSVKCRNGQQGCRATFPLSNEYLHISTCPYEWQICPHEGCGQQVLRKDVQAHD 131

  Fly   116 ---------CSKGCGMKVPKDEMSRHNCVFEL--RELVEKLAKE--VSDLKQKQSDMEEQSSSQR 167
                     |..|||..:.::..::|||..||  |.|.|:..:.  .::|::|...|:.:.:..:
Zfish   132 QSCTHWRQLCPMGCGTLLVRENQTQHNCYRELQQRYLAERRKQRAIAANLRRKMQRMQSRMAQIK 196

  Fly   168 REMEL 172
            |::.|
Zfish   197 RQINL 201

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 17/37 (46%)
USP8_interact 137..319 CDD:286082 10/40 (25%)
rnf151XP_001343919.2 RING_Ubox 20..58 CDD:327409 17/39 (44%)
zf-TRAF 102..157 CDD:280357 6/55 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C32029458
eggNOG 1 0.900 E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D918518at2759
OrthoFinder 1 1.000 FOG0001632
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR15315
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.