DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and PAS2

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001190277.1 Gene:PAS2 / 830912 AraportID:AT5G10480 Length:230 Species:Arabidopsis thaliana


Alignment Length:237 Identity:69/237 - (29%)
Similarity:125/237 - (52%) Gaps:34/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 KKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKT-YANVGNAF-KFIQLLQ---YLEVMHP 207
            ::||:..||..:|.|:..::.:        .:.::.:| |.||.:|. |.:||.|   .||::|.
plant     9 RRVYLTLYNWIVFAGWAQVLYL--------AITTLKETGYENVYDAIEKPLQLAQTAAVLEILHG 65

  Fly   208 MFGYTKGSPV---VPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWS---------LVELVR 260
            :.|..: |||   :|  |:..|.|:.:.::...|.:.:..:|..:.|.||         :||::|
plant    66 LVGLVR-SPVSATLP--QIGSRLFLTWGILYSFPEVRSHFLVTSLVISWSITEFPITTWIVEIIR 127

  Fly   261 YPYY-LAQLLGREVGLLTWLRYTIWIPLYPMGILCE-GIIVLRNIPYIEETKRFTVEMPNPWNIT 323
            |.:: ..:.||.......||||:.::.|||.||..| |:|.|. :|:|:.::.::|.|||..|.:
plant   128 YSFFGFKEALGFAPSWHLWLRYSSFLLLYPTGITSEVGLIYLA-LPHIKTSEMYSVRMPNILNFS 191

  Fly   324 FDMVLFLKIYLMLLIIPGSYLVMSHMAKLRSKKLGKGRAKRQ 365
            ||. .:..|.::.:.:|||..:..:|...|.:.|.|  :||:
plant   192 FDF-FYATILVLAIYVPGSPHMYRYMLGQRKRALSK--SKRE 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 53/176 (30%)
PAS2NP_001190277.1 PLN02838 1..230 CDD:166479 68/235 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.