DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and Hacd4

DIOPT Version :10

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_080036.1 Gene:Hacd4 / 66775 MGIID:1914025 Length:232 Species:Mus musculus


Alignment Length:202 Identity:67/202 - (33%)
Similarity:109/202 - (53%) Gaps:3/202 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 KKVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYT 212
            |.||:..|.|..|.|:.:|:..|.|.::..|.||:..|:..:|...:..|.:..||::|...|..
Mouse    16 KNVYLFIYYLIQFCGHSWILANMTVRFFSFGKDSMADTFYAIGLVMRVCQSISLLELLHIYIGIE 80

  Fly   213 KGSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLT 277
            .......|.|::.|..|||.:|..:..:..|.||..:||:|:|:::|||.|.:..::|.....||
Mouse    81 SNQLFPRFLQLTERVIILFGVITSQEEVQEKCVVCVLFILWNLLDMVRYTYSMLSVIGTSYAALT 145

  Fly   278 WLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLIIPGS 342
            ||..|:|:|:||:.:|.|...:.:::||.|.....:..:|...:..|..|  ||:|||:|.| |.
Mouse   146 WLSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTNSTVLPFDLSTCFPYV--LKLYLMMLFI-GM 207

  Fly   343 YLVMSHM 349
            |...||:
Mouse   208 YFTYSHL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..359 CDD:461286 52/153 (34%)
Hacd4NP_080036.1 PTPLA 65..223 CDD:461286 52/153 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.