DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and ptges3a

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_998335.1 Gene:ptges3a / 406449 ZFINID:ZDB-GENE-040426-2200 Length:159 Species:Danio rerio


Alignment Length:113 Identity:30/113 - (26%)
Similarity:54/113 - (47%) Gaps:8/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 WSQTKQTLLLKVDLKDAKGAIADFSPVSVNFSANGHGARGVNAYKF--ELHFYALIDDENATFVV 72
            |...::.:.::..::|:|.....|....::||..|    |.:..|.  |:.....||..::....
Zfish     8 WYDRREAVFIEFCIEDSKDVQVKFDKTKLDFSCVG----GTDNMKHHNEVDLLEAIDPNDSKHKR 68

  Fly    73 SDNKIELQIRKLEP-EWWPRLVATPQKPHWLKIDFDRWRT-EDDVEVE 118
            :|..:...::|.|| :.||||.....|.:||.:||:.|:. |||.:.|
Zfish    69 TDRSVFCCLKKAEPGKSWPRLTKEKAKLNWLSVDFNNWKDWEDDSDEE 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222 27/107 (25%)
PTPLA 197..357 CDD:282269
ptges3aNP_998335.1 alpha-crystallin-Hsps_p23-like 3..109 CDD:294116 26/104 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.