DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and AgaP_AGAP003815

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_310376.5 Gene:AgaP_AGAP003815 / 1271555 VectorBaseID:AGAP003815 Length:235 Species:Anopheles gambiae


Alignment Length:223 Identity:82/223 - (36%)
Similarity:116/223 - (52%) Gaps:11/223 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTK 213
            |.|:..||.|.|.|:.||.|.. :.::.....|:...::.||.|..|.|:|..|||:|.|.|...
Mosquito    14 KGYLTLYNTAQFAGWTYIFVQF-IQHFAVHGQSLDTLWSRVGQATFFFQMLAILEVVHAMVGIVP 77

  Fly   214 GSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREV-GLLT 277
            .:..:.|.||.||..|:...|:..|.....|.:......|||.|::||.||:|.||...| .||.
Mosquito    78 SNVAMTFLQVFGRCMIVAGAIEGTPTGQKSPGLPLALFCWSLTEIIRYSYYVAHLLLPAVPSLLV 142

  Fly   278 WLRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLL----I 338
            ||||||:||:||.|.|.|.:.......||.:|.:::||:||.:|.:|....|  |::|.:    :
Mosquito   143 WLRYTIFIPMYPCGFLGELLCSYWAQSYIRDTGKWSVELPNRFNFSFSFYYF--IWIMAVCYMPL 205

  Fly   339 IPGSYLVMSHMAKLRSKKLGKGRAKRQQ 366
            .|..||   ||...|.|..|:|...||:
Mosquito   206 FPQMYL---HMFAQRRKVFGRGTQTRQK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 63/164 (38%)
AgaP_AGAP003815XP_310376.5 PTPLA 61..221 CDD:282269 63/164 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.