DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and AgaP_AGAP003814

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:XP_310375.4 Gene:AgaP_AGAP003814 / 1271554 VectorBaseID:AGAP003814 Length:231 Species:Anopheles gambiae


Alignment Length:224 Identity:70/224 - (31%)
Similarity:109/224 - (48%) Gaps:9/224 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 KVYMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTK 213
            |.|:|.||.|..||:.|::..: :.||.....:....:..:|......|....||::|.......
Mosquito    11 KSYLILYNAAQVVGWCYMLYQL-IAYYTIDKGTEKTLWDYLGFTVILFQNAALLEIVHAFTRIVP 74

  Fly   214 GSPVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLTW 278
            .:||:..|||..|..::..::...|.....|.:....:.||:.|::||.||...|:.....||.:
Mosquito    75 SNPVITTFQVLSRVMVVCGVVMATPTGKVSPGLPLAILAWSVTEIIRYAYYALNLIDAVPQLLIF 139

  Fly   279 LRYTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLMLLI--IPG 341
            ||||.:|.|||.|:..|.:.......::..||::::||||.:|.||..:.||...::|.|  .|.
Mosquito   140 LRYTTFIVLYPTGVTGELLCFFWAQSHVASTKQWSIEMPNTYNFTFSYLYFLWAVMLLYIPLFPQ 204

  Fly   342 SYLVMSHMAKLRSKKLGKGR---AKRQQH 367
            .||   ||...|.|.||.|.   |.:|:|
Mosquito   205 LYL---HMFAQRKKILGSGSSSGATKQKH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 52/161 (32%)
AgaP_AGAP003814XP_310375.4 PTPLA 58..217 CDD:282269 52/161 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5198
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.