DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hacd2 and hacd2

DIOPT Version :9

Sequence 1:NP_609655.2 Gene:Hacd2 / 34762 FlyBaseID:FBgn0032524 Length:371 Species:Drosophila melanogaster
Sequence 2:NP_001135628.1 Gene:hacd2 / 100216187 XenbaseID:XB-GENE-5998532 Length:241 Species:Xenopus tropicalis


Alignment Length:203 Identity:60/203 - (29%)
Similarity:101/203 - (49%) Gaps:4/203 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 YMIFYNLAMFVGYLYIMVVMGVLYYRDGVDSIGKTYANVGNAFKFIQLLQYLEVMHPMFGYTKGS 215
            |::.||:.|..|:|.|.|.:...|...|  |....|.::....||.|....||:.|...|....|
 Frog    30 YLVIYNVVMTAGWLVIAVGLVRTYLTKG--SYHNLYYSIERPLKFFQTGALLEIGHCAVGIVPSS 92

  Fly   216 PVVPFFQVSGRNFILFLMIDMEPRMYAKPVVFYVFIIWSLVELVRYPYYLAQLLGREVGLLTWLR 280
            .|:..|||..|.|:.:.:......:..:..|....:.|::.|::||.:|...||.....::.|.|
 Frog    93 VVLTAFQVMSRVFLTWAVTHSVREVQNEDSVLLFVVAWTITEIIRYSFYTFSLLNHLPYIIKWAR 157

  Fly   281 YTIWIPLYPMGILCEGIIVLRNIPYIEETKRFTVEMPNPWNITFDMVLFLKIYLM--LLIIPGSY 343
            ||::|.|||||:..|.:.:...:|.:::|..:::.:||.:|.:||...||.:.:|  :.|.|..|
 Frog   158 YTLFIVLYPMGVTGELLTIYAALPTVKKTGLYSISLPNKYNFSFDYYTFLILVMMSYIPIFPQLY 222

  Fly   344 LVMSHMAK 351
            ..|.|..:
 Frog   223 FHMFHQRR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hacd2NP_609655.2 p23_hB-ind1_like 6..114 CDD:107222
PTPLA 197..357 CDD:282269 46/157 (29%)
hacd2NP_001135628.1 PTPLA 74..233 CDD:367918 46/157 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1458293at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.