DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tehao and Lrrc3c

DIOPT Version :10

Sequence 1:NP_477438.1 Gene:Tehao / 34761 FlyBaseID:FBgn0026760 Length:795 Species:Drosophila melanogaster
Sequence 2:NP_001385522.1 Gene:Lrrc3c / 287668 RGDID:1563281 Length:255 Species:Rattus norvegicus


Alignment Length:202 Identity:54/202 - (26%)
Similarity:78/202 - (38%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 CWVQRSVGSLIVDCRGTSLEELPD-LPRTTLLSTVLKVGNNSLTSLPT-VSEHSGYANVSGLFLS 489
            |::....|.....|....|..:|. :|..|   ..|.:..|.|.|:|. ..:|  ...:..|.||
  Rat    31 CYIAEEAGEQTFRCSRAGLSAVPSGIPNDT---RKLYLDANQLASVPAGAFQH--LPALEELDLS 90

  Fly   490 DNNLTSL-GSGDQ-LPDNLTHLDVRGNQIQSLSDEFLLFLQEPNNTMTLSLSGNPITCGCESLSL 552
            .|.|..| |:..| |...|.|||:..||:.|:.....:.||     :.::||.||..|.|....:
  Rat    91 HNVLVHLSGAAFQGLEATLRHLDLSANQLASVPVAAFVGLQ-----IQVNLSANPWRCDCALQEV 150

  Fly   553 LFFVRTNPQRVRDIADIVCTKQKKSFQQMEAF-------ELC---------PSYVLLISCVVGGL 601
            |..||..|   .....|||..:.:.......|       |||         .:.|.|:..:.|.|
  Rat   151 LRHVRLAP---GSGTGIVCGPEARPDLVGHEFLLLTGEEELCGTGRGGTRRSTDVALLVTMGGWL 212

  Fly   602 VIVICLL 608
            .:|:..|
  Rat   213 TLVVAYL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TehaoNP_477438.1 LRR 184..>541 CDD:443914 33/117 (28%)
leucine-rich repeat 185..207 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..261 CDD:275380
leucine-rich repeat 262..284 CDD:275380
leucine-rich repeat 285..309 CDD:275380
leucine-rich repeat 310..333 CDD:275380
leucine-rich repeat 334..357 CDD:275380
leucine-rich repeat 358..381 CDD:275380
leucine-rich repeat 445..482 CDD:275380 10/38 (26%)
leucine-rich repeat 483..505 CDD:275380 9/23 (39%)
TIR 643..779 CDD:214587
Lrrc3cNP_001385522.1 leucine-rich repeat 40..59 CDD:275378 4/18 (22%)
leucine-rich repeat 60..83 CDD:275378 7/27 (26%)
LRR_8 61..119 CDD:404697 20/59 (34%)
leucine-rich repeat 84..107 CDD:275378 9/22 (41%)
leucine-rich repeat 109..131 CDD:275378 7/21 (33%)
leucine-rich repeat 132..143 CDD:275378 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.