DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and wdr34

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001099160.1 Gene:wdr34 ZFINID:ZDB-GENE-070928-9 Length:501 Species:Danio rerio

Alignment Length:349 Identity:80/350 (23%)
Similarity:121/350 (35%) Gaps:71/350 (20%)


  Fly   218 WNLD----DATRPAAHYDSRRVVRVAKVCL----RDESYMVGGLQEGQVGFWLTEN-------QG 267
            ||:|    :..||....|    |....:||    ...|.:.|||..|:|..|.|..       |.
Zfish   163 WNVDRQNLNPKRPDVIID----VATPVMCLCFHPVRPSVVAGGLYSGEVVVWDTSRSQDLILAQT 223

  Fly   268 GPKSMCPLEACHREATTAICWVHSKLNTEF--YSGSLDGSIKYW-----DTRDLLMPVHEVLAEP 325
            |..:     ..|||....|.||......||  .|....|.:..|     :.:.||...:.::.:.
Zfish   224 GMSA-----DTHREPVYQINWVPGARRGEFSVLSAGSGGRVLLWTIDGSEAKLLLSSGYALVRQQ 283

  Fly   326 DPQTVQNRQDAHGVTFLEFEYTIPVRFIFCT--DMGYLFVGNRKG-------------TTPQD-- 373
            .||       :...:......||.|..:..:  |:....||:..|             ..|.|  
Zfish   284 MPQ-------SGAASKTRGSLTIGVTAVALSPWDLDTFLVGSEGGLVLKCSFSSETAAAVPSDGE 341

  Fly   374 -TIVAAYQLFA-----GPIRCVMRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSG 432
             .|:.|...|:     |||..|..:||....|:.||...:......::.||........:.:...
Zfish   342 SVILRAPMQFSFSPRGGPIHSVHFSPFHRNLFVSVGTDGLAHLHSVLQPCPLLALRVSDSYVFGV 406

  Fly   433 AWSTGRCSLFCIGDNMGNLEFWDLLMSHKRPILTIKYK------YAVTHLVFKPDGT-MLTVSLA 490
            .||..|..:|......|.::.:||.....||:.||...      |.   |.|.|..| :|.|..|
Zfish   407 RWSPTRPLVFAAVTGQGLVQMFDLGRRSLRPVATIDQNAGGQPAYC---LEFNPKHTNLLAVGNA 468

  Fly   491 NGDCLMLRLEEGMRSATNKEKSLM 514
            :|...:.:|...:.....||.:::
Zfish   469 DGSVNIWQLSAELTEQGAKETAML 492

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 21/79 (27%)
WD40 261..>512 CDD:225201 65/295 (22%)
WD40 279..492 CDD:295369 57/250 (23%)
WD40 repeat 284..332 CDD:293791 12/55 (22%)
WD40 repeat 386..422 CDD:293791 9/36 (25%)
WD40 repeat 429..454 CDD:293791 5/25 (20%)
wdr34NP_001099160.1 WD40 66..481 CDD:225201 78/337 (23%)
WD40 repeat 130..180 CDD:293791 5/17 (29%)
WD40 repeat 187..229 CDD:293791 12/47 (26%)
WD40 repeat 235..296 CDD:293791 12/68 (18%)
WD40 repeat 301..338 CDD:293791 6/37 (16%)
WD40 repeat 361..399 CDD:293791 8/38 (21%)
WD40 repeat 403..442 CDD:293791 11/39 (28%)
WD40 repeat 450..477 CDD:293791 9/30 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.