DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and dic1

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001342791.1 Gene:dic1 PomBaseID:SPBC646.17c Length:544 Species:Schizosaccharomyces pombe

Alignment Length:510 Identity:102/511 (20%)
Similarity:163/511 (32%) Gaps:97/511 (19%)


  Fly    48 PINERTQLSEQYAASSVLTHNVTLD-SHGLNHYEGGWNV--------KEVNIMDEESTMRYRKKV 103
            |.|...|.....:.||.|..:..|. |.....|...:||        |.|||.:....:::..|.
pombe    55 PTNLTPQTYSLESKSSNLVSDCELKISSVYQSYSSTFNVSNHVPSISKTVNIRETSKHLKHSTKA 119

  Fly   104 ERDDSWGIEVNQLMHAAMDISSANNAVNIYEDFFVDLPEDLGRGISMKIAARGTHVFHDLWIPSR 168
            .:        ..|..:|::|...||       |.....:.|.|.    :..:...:|.|..:..:
pombe   120 PK--------CSLPTSALEIDHLNN-------FLHSSAKILDRA----LCDQSNQLFTDYTVKKK 165

  Fly   169 RLMTCEWL-NNDPNQFLLFYSNRMSLT-----------------PDYTKQLNTLPDFGNDNPHAF 215
            .......| .|..|....|...:::|.                 ..|.|....|...|     ..
pombe   166 SKKNKSQLEENGLNHLFTFQDEKITLNSVVNSISYSSFFEELLITSYAKPKEALRTRG-----LA 225

  Fly   216 YIWNLDDATRPAAHYDSRRVVRVAKVCLRDESYMVGGLQEGQVGFW-LTENQGGPKSMCPLEACH 279
            .:||......|.:...:|..:.|.|........:.||...|||..| |.:.|........:...|
pombe   226 IVWNQRWKNSPESVLKARSEITVCKPSPFHPQLIAGGAYNGQVFLWDLRQGQYPVSFTTIISGGH 290

  Fly   280 REATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEPDPQTVQNRQDAHGVTFLEF 344
            .|..|.|.::::..:....:.|.||.:..|:......|...:...   ..|.:.......|.|.|
pombe   291 LEPVTDITYINNPPSNNIVTCSTDGLVHIWEPDMFSRPSETICLS---SQVDSSSQCIPATCLSF 352

  Fly   345 EYTIP---VRFIFCTDMGYLFVGNR------KGTTPQDTIVAAYQLFAGPIRCV---MRNPFFVK 397
               ||   :.|:...:.|.|..|.|      |...|.:.....:.:|...|..:   .:|.|..|
pombe   353 ---IPENNMEFLVGAEDGKLQRGYRSDYSETKAVQPSNVSYEGHNVFISGIDVMTSNSQNVFLEK 414

  Fly   398 N--FLVVG--DWRVRIW-----------------SEEV--KNCPSTFYFRRPNQLLSGAWSTGRC 439
            |  |.:..  ||.||:|                 .|:|  .:|.:   |.....:....|.....
pombe   415 NKDFALTSSFDWTVRLWQCSPSRNQHELVPSNDLDEQVIINSCKT---FTHKAMVFDVKWCVSEP 476

  Fly   440 SLFCIGDNMGNLEFWDLLMSHKRPILT-IKYKYAVTHLVFKPDGTMLTVSLANGD 493
            ..|...|.:|||..|||....:.|:.: |.....:..:.::|:...|.....||:
pombe   477 CCFASVDALGNLNLWDLQKDVEAPVTSDIPDGKPLNKIAWQPEKRNLACGGLNGN 531

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 16/66 (24%)
WD40 261..>512 CDD:225201 56/271 (21%)
WD40 279..492 CDD:295369 52/249 (21%)
WD40 repeat 284..332 CDD:293791 8/48 (17%)
WD40 repeat 386..422 CDD:293791 14/62 (23%)
WD40 repeat 429..454 CDD:293791 6/25 (24%)
dic1NP_001342791.1 WD40 223..536 CDD:330360 68/324 (21%)
WD40 repeat 247..289 CDD:293791 10/42 (24%)
WD40 repeat 294..339 CDD:293791 8/48 (17%)
WD40 repeat 348..390 CDD:293791 12/45 (27%)
WD40 repeat 397..453 CDD:293791 13/56 (23%)
WD40 repeat 466..504 CDD:293791 10/38 (26%)
WD40 repeat 511..535 CDD:293791 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
10.960

Return to query results.
Submit another query.