DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and dync1i1

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_009290517.1 Gene:dync1i1 ZFINID:ZDB-GENE-061215-62 Length:647 Species:Danio rerio

Alignment Length:403 Identity:76/404 (19%)
Similarity:146/404 (36%) Gaps:77/404 (19%)


  Fly    91 MDEESTMRYRKKVERDDSWGIEVNQLMHAAMDISSANNAVNIYE-------DFFVDL-------- 140
            ::||.|... ::|...:....|..|::|:...:...:.::.:.|       |.|.|.        
Zfish   201 LEEEKTQEV-EEVHPRELTNEEKEQIVHSEDFLFFFDRSIRVVERVLAEDKDIFFDYSGRDMEDK 264

  Fly   141 PEDLGRGISMKIAARGTHVFHDLWIPSRRLMTCEWLNNDPNQFLLFYSNRMSLTPDYTKQLNTLP 205
            ..||..|.::..   ..|.:.:.|...|.:.:.:|                  :|.|.:.|....
Zfish   265 EGDLQAGSNLSF---NRHFYDEHWSKHRVVTSLDW------------------SPQYPELLVASY 308

  Fly   206 DFGNDNPH----AFYIWNL--DDATRPAAHYDSRRVVRVAKVCLRDESYMVGGLQEGQVGFWLTE 264
            :...|.||    ...:||:  ..|| |...:..:..|..........:.::||...||:..|  :
Zfish   309 NTNEDAPHEPDGVVLVWNMKFKKAT-PEYIFHCQSSVMSVGFAQFHPNLVIGGTYSGQIAMW--D 370

  Fly   265 NQG---GPKSMCPLEA-CHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEP 325
            |:.   .|....||.| .|......:..|.::......:.|.||.:..|..        ::|::|
Zfish   371 NRSHRRTPVQRTPLSATAHTHPVYCVNVVGTQNANNLITVSTDGKMCSWSL--------DMLSQP 427

  Fly   326 DP--QTVQNRQDAHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGPIRC 388
            ..  :.:.|:.....||.:.|..:....::..::.|.::..:|.|:  :..|...:....||:..
Zfish   428 QESMELIYNKSKPVAVTCMAFPASDVNNYVVGSEEGTVYTASRHGS--KAGIGEIFDGHQGPVTG 490

  Fly   389 V----------MRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSGAWSTGRCSLFC 443
            :          ..:.|...:|    ||.|::||.: .|.|...:....:.:....||....:||.
Zfish   491 ISCHNAVGPVDFSHLFTTSSF----DWTVKLWSTK-HNKPLYSFEDNADYVYDVMWSPVHPALFA 550

  Fly   444 IGDNMGNLEFWDL 456
            ..|..|.|:.|:|
Zfish   551 TVDGNGRLDLWNL 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 16/69 (23%)
WD40 261..>512 CDD:225201 42/213 (20%)
WD40 279..492 CDD:295369 36/191 (19%)
WD40 repeat 284..332 CDD:293791 7/50 (14%)
WD40 repeat 386..422 CDD:293791 9/46 (20%)
WD40 repeat 429..454 CDD:293791 7/25 (28%)
dync1i1XP_009290517.1 Dynein_IC2 147..175 CDD:288403
WD40 215..608 CDD:225201 72/389 (19%)
WD40 284..607 CDD:295369 61/317 (19%)
WD40 repeat 292..337 CDD:293791 12/64 (19%)
WD40 repeat 347..388 CDD:293791 10/43 (23%)
WD40 repeat 394..437 CDD:293791 8/51 (16%)
WD40 repeat 443..490 CDD:293791 9/49 (18%)
WD40 repeat 498..530 CDD:293791 9/37 (24%)
WD40 repeat 536..574 CDD:293791 9/29 (31%)
WD40 repeat 582..608 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.