DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and dync1i2

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_012825730.1 Gene:dync1i2 XenbaseID:XB-GENE-960812 Length:655 Species:Xenopus tropicalis

Alignment Length:487 Identity:99/488 (20%)
Similarity:175/488 (36%) Gaps:78/488 (16%)


  Fly    86 KEVNIMDEESTMRYRKKVER--DDSWGIEVNQLMHAAMDIS-----------SANNAVNIYEDFF 137
            |.|.|.:|:...:..:|.|.  .:....|..|::|:...:|           :.:..|||:.|:.
 Frog   201 KAVAIQEEDKPEKKEEKTEAPPHELTEEEKQQIIHSEEFVSFFDHSTRIVERALSEHVNIFFDYS 265

  Fly   138 -VDLPEDLGR---GISMKIAARGTHVFHDLWIPSRRLMTCEWLNNDPNQFLLFYSNRMSLTPDYT 198
             .||.|..|.   |..:..   ....|.:.|...|.:...:|.:..|...:..|:|         
 Frog   266 GRDLEEKEGEIQAGAKLSF---NRQFFDERWSKHRVVSCLDWSSQYPELLVASYNN--------- 318

  Fly   199 KQLNTLPDFGNDNPH----AFYIWNLD-DATRPAAHYDSRRVVRVAKVCLRDESYMVGGLQEGQV 258
                     ..|.||    ...:||:. ....|...:..:..|..|.......:.:|||...||:
 Frog   319 ---------NEDAPHEPDGVALVWNMKYKKMTPEYVFHCQSAVMSAAFARFHPNLVVGGTYSGQI 374

  Fly   259 GFW-LTENQGGPKSMCPLE-ACHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEV 321
            ..| ...|:..|....||. |.|......:..|.::......|.|.||.|..|..        ::
 Frog   375 VLWDNRSNKRTPVQRTPLSAAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSL--------DM 431

  Fly   322 LAEPDP--QTVQNRQDAHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAG 384
            |::|..  :.|..:..|..||.:.|.......|:..::.|.::...|.|:  :..|...::...|
 Frog   432 LSQPQDSMELVHKQSKAVAVTCMSFPVGDVNNFVVGSEEGSVYTACRHGS--KAGISEMFEGHQG 494

  Fly   385 PIRCV----------MRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSGAWSTGRC 439
            ||..:          ..:.|...:|    ||.|::|:.: .|.|...:....:.:....||....
 Frog   495 PITGIHCHSAVGAVDFSHLFVTSSF----DWTVKLWTTK-NNKPLYSFEDNSDYVYDVMWSPTHP 554

  Fly   440 SLFCIGDNMGNLEFWDLLMSHKRPI--LTIKYKYAVTHLVFKPDGTMLTVSLANGDCLMLRLEEG 502
            :||...|.:|.|:.|:|....:.|.  :|::...|:..:.:...|..:.|..:.|:..:..:.|.
 Frog   555 ALFACVDGVGRLDLWNLNNDTEVPTASITVEGNPALNRVRWTHSGREIAVGNSEGEIFIYDVGEQ 619

  Fly   503 MRSATNKEKSLMMSMFEREIQRCKLLEAREEE 534
            :....|.|    .:.|.|.:.......|..||
 Frog   620 IAVPRNDE----WTRFARTLAEINANRADAEE 647

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 19/67 (28%)
WD40 261..>512 CDD:225201 55/267 (21%)
WD40 279..492 CDD:295369 45/227 (20%)
WD40 repeat 284..332 CDD:293791 10/50 (20%)
WD40 repeat 386..422 CDD:293791 9/46 (20%)
WD40 repeat 429..454 CDD:293791 7/25 (28%)
dync1i2XP_012825730.1 Dynein_IC2 154..182 CDD:288403
WD40 repeat 299..346 CDD:293791 10/65 (15%)
WD40 372..>616 CDD:225201 54/259 (21%)
WD40 397..>622 CDD:295369 47/240 (20%)
WD40 repeat 451..498 CDD:293791 11/49 (22%)
WD40 repeat 506..538 CDD:293791 8/37 (22%)
WD40 repeat 544..582 CDD:293791 10/38 (26%)
WD40 repeat 590..616 CDD:293791 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.