DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and Dnai2

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001261723.1 Gene:Dnai2 FlyBaseID:FBgn0036195 Length:585 Species:Drosophila melanogaster

Alignment Length:549 Identity:182/550 (33%)
Similarity:279/550 (51%) Gaps:49/550 (9%)


  Fly     7 QFILSRERRRFGRQCLFTDRNEMILSVQPSGRLRLKYILRNPINERTQLSEQYAASSVLTHNVTL 71
            ::|..:|||.||.:..|.|::|::.:...:..|...|||:||::..||.:.|.:.|...|...|.
  Fly     2 EYIFKKERRSFGARVHFEDKDEVVFTENSNPELVKSYILKNPVDRVTQYAGQTSLSVANTERATY 66

  Fly    72 DSHGLNHYEGGWNVKEVNIMDEESTMRYRKKVERDDSWGIEVNQLMHAAMDISSANNAVNIYEDF 136
            .|.|:.|.|||| .|::|:.|.|.|:||::|:|:|:::..:|..|..........||||||||::
  Fly    67 KSTGITHNEGGW-PKDINMHDPEQTVRYKRKIEKDENYITQVMNLTKPMEHYIHQNNAVNIYENY 130

  Fly   137 F-----VDLPEDLGRGISMKIAARGTHVFHD---LWIPSRRLMTCEWLNNDPNQFLLFYSNRMSL 193
            |     ..|||        ...:|..:|:.|   :.:|.:.|   .|..:...:..:.:.: |..
  Fly   131 FENLDPAPLPE--------PCKSRTVNVYRDPNPIKVPVKHL---SWSPDGGIKMAVSHCD-MRF 183

  Fly   194 TPDYTKQ-LNTLPDFGNDNPHAFYIWNLDDATRPAAHYDSRRVVRVAKVCL----RDESYMVGGL 253
            ..|.:.| .|:            |||.:::...|....:.    :|..|||    :|.:.:|.|:
  Fly   184 QGDKSNQKCNS------------YIWEVENPNEPFLTLEP----KVPCVCLEYNQKDPTSLVSGM 232

  Fly   254 QEGQVGFWLTENQGGPKSMCPLEACHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPV 318
            ..|||..|.|.:...|..:...|.|||:...::.|.:||..|||:||..||.:.:||||.|..|:
  Fly   233 YNGQVAAWDTRHGKLPVMISEREVCHRDPVNSVLWNNSKSGTEFFSGGSDGQVLWWDTRKLTEPL 297

  Fly   319 HEVLAEPDPQTVQNRQDAHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFA 383
            ..:|.:|.....|:...::|::.||:|.|||.||:..|:||.||..||||.||.:.|........
  Fly   298 DRLLMDPVKSDDQDLSRSYGISVLEYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKIQIRMMCHL 362

  Fly   384 GPIRCVMRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSGAWSTGRCSLFCIGDNM 448
            ||:..:.|||.||||||.||||..|||||:.:.....:.....:.|..||||..:.|.|.|....
  Fly   363 GPVYAITRNPAFVKNFLTVGDWCARIWSEDCRESSIIWTKSSSSMLTDGAWSYTKVSQFFITRMD 427

  Fly   449 GNLEFWDLLMSHKRPILTIKY----KYAVTHLVFKPDGTMLTVSLANGDCLMLRLEEGMRSATNK 509
            |.|:.||||.....|:||:|.    .|.|.   ...:|..::.....|...::.:.:.|..:...
  Fly   428 GVLDTWDLLQQQNEPVLTVKVCDEPLYCVR---TNENGKFVSCGSQLGATFLVEVSDNMVMSAKN 489

  Fly   510 EKSLMMSMFEREIQRCKLLEAREEEIKLK 538
            :|.|:.:|||||.:|.|:|||:..|.|||
  Fly   490 DKPLLTAMFERENRREKILEAKSRESKLK 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 24/65 (37%)
WD40 261..>512 CDD:225201 91/255 (36%)
WD40 279..492 CDD:295369 83/217 (38%)
WD40 repeat 284..332 CDD:293791 19/48 (40%)
WD40 repeat 386..422 CDD:293791 18/36 (50%)
WD40 repeat 429..454 CDD:293791 10/25 (40%)
Dnai2NP_001261723.1 WD40 <160..482 CDD:225201 110/345 (32%)
WD40 repeat 162..208 CDD:293791 10/62 (16%)
WD40 212..469 CDD:295369 98/260 (38%)
WD40 repeat 215..254 CDD:293791 12/39 (31%)
WD40 repeat 262..304 CDD:293791 17/42 (40%)
WD40 repeat 318..355 CDD:293791 20/37 (54%)
WD40 repeat 365..401 CDD:293791 18/36 (50%)
WD40 repeat 408..433 CDD:293791 10/25 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C252571019
eggNOG 1 0.900 E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4268
OrthoDB 1 1.010 D217312at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12442
RoundUp 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.