DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10859 and Sdic2

DIOPT Version :9

Sequence 1:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001285481.1 Gene:Sdic2 / 2768883 FlyBaseID:FBgn0053497 Length:543 Species:Drosophila melanogaster


Alignment Length:477 Identity:100/477 - (20%)
Similarity:180/477 - (37%) Gaps:81/477 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 KEVNIMDEESTMRYRKKV----ERDDSWGIEVNQLMHAAMDISSANNAVNIYEDFFVDLPEDLGR 146
            ||||.:.||     :|::    |....:.:...:::..|:   |.|  |:||.|:       :|.
  Fly   117 KEVNELSEE-----QKQMIILSENFQRFVVRAGRVIERAL---SEN--VDIYTDY-------IGG 164

  Fly   147 GISMKIAARGTH-------VFHD-LWIPSRRLMTCEWLNNDPNQFLLFYSNRMSLTPDYTKQLNT 203
            |.|.:.....:|       ||:| .|..:|.:.:.:|..:.|...:..|.|.             
  Fly   165 GDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN------------- 216

  Fly   204 LPDFGNDNPHAFYIWNL---DDATRPAAHYDSRRVVRVAKVCLR--DESYMVGGLQEGQVGFWLT 263
             .:..|:......:||.   ........|..|    .|...|..  :.:.::||...||:..|..
  Fly   217 -EESPNEPDGVVMVWNTKFKKSTPEDVFHCQS----AVMSTCFAKFNPNLILGGTYSGQIVLWDN 276

  Fly   264 ENQ-GGPKSMCPLE-ACHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEP- 325
            ..| ..|....||. |.|......:..|.::......|.|.||.:..|..        ::|::| 
  Fly   277 RVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSL--------DMLSQPQ 333

  Fly   326 DPQTVQNRQD-AHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGPIRCV 389
            |...:|.||. |..:|.:.|........:..::.||::..:|.|.  :..:...|:...|||..:
  Fly   334 DTLELQQRQSKAIAITSMAFPANEINSVVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGI 396

  Fly   390 -----MRNPFFVKNFLVVG-DWRVRIWSEEVKNCPSTFYFR-RPNQLLSGAWSTGRCSLFCIGDN 447
                 ..:|.|...||... ||.:::||  :|:....:.|. ..:.::..|||....:||...|.
  Fly   397 STHYNQLSPDFGHLFLTSSIDWTIKLWS--LKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDG 459

  Fly   448 MGNLEFWDLLMSHKRPI--LTIKYKYAVTHLVFKPDGTMLTVSLANGDCLMLRLEEGMRSATNKE 510
            .|.|:.|:|....:.|.  :.:....|:..:.:.|.|..:.:....|...:..:.|.:...:..|
  Fly   460 SGRLDLWNLNQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE 524

  Fly   511 KSLMMSMFEREIQRCKLLEARE 532
                .|.|...:...|:.::.|
  Fly   525 ----WSRFNTHLSEIKMNQSDE 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 16/66 (24%)
WD40 261..>512 CDD:225201 57/263 (22%)
WD40 279..492 CDD:295369 48/223 (22%)
WD40 repeat 284..332 CDD:293791 9/48 (19%)
WD40 repeat 386..422 CDD:293791 10/41 (24%)
WD40 repeat 429..454 CDD:293791 8/24 (33%)
Sdic2NP_001285481.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 19/77 (25%)
WD40 196..512 CDD:295369 70/345 (20%)
WD40 repeat 196..245 CDD:293791 7/62 (11%)
WD40 <224..523 CDD:225201 66/314 (21%)
WD40 repeat 251..289 CDD:293791 8/37 (22%)
WD40 repeat 298..337 CDD:293791 9/46 (20%)
WD40 repeat 349..435 CDD:293791 19/89 (21%)
WD40 repeat 441..479 CDD:293791 11/37 (30%)
WD40 repeat 487..513 CDD:293791 3/25 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435290
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.