DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and Wdr63

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_766452.2 Gene:Wdr63 MGIID:3045269 Length:923 Species:Mus musculus

Alignment Length:782 Identity:154/783 (20%)
Similarity:255/783 (33%) Gaps:242/783 (31%)


  Fly     8 FILSRERRRFGRQCLFTDRNEMILSVQPSGRLRLKYILRNPINERTQLSEQYAASSVLTHNVTLD 72
            :::||:|..||....|:|:|        :..::..||      |.|...|:....|.:..:|.|.
Mouse   186 YMISRKRSEFGAPVTFSDQN--------ASSVKDAYI------ECTSYPEKNYTLSQVEKDVGLQ 236

  Fly    73 SHGLNHYEGGWNVKEVN-----IMDEESTMRY--RKKVERDDSWGIEVNQLMHAAMDISSA---- 126
            ...        .||:.:     ...:.:|.:|  |:..|.:.|...:...|:....::|::    
Mouse   237 VIA--------EVKDTSTQTKWAFPKNATTQYYPREFSEEEKSLIGKSKSLVDFFNNVSTSVEVA 293

  Fly   127 ---NNAVNIYEDFFVDLPEDLGR-GISMKIAARGTHVFHDLWIPSRRLMTC-EWLNNDPNQF-LL 185
               |..:|.:.|.:.:|.|:... |.......:....|.||.....:::|| .|   .|..| |:
Mouse   294 LQQNEIMNTFIDDWKNLAEEESTFGDKTDTHLKEYQSFTDLHNTMEKMITCVSW---HPTIFGLI 355

  Fly   186 FYSNRMSLTPDYTKQLNTLPDFGND-----NPHAFYIWNLDDATRPAAHYDSRRVVRVAKVCLRD 245
            ..|..:.|:  |.:::.      |.     .|.....|:..|...|....:|...:...:.|..|
Mouse   356 VVSVAVRLS--YEERVQ------NSGRLLLQPSLLLFWSFSDPIHPQLMLESPDDIFCFEFCPSD 412

  Fly   246 ESYMVGGLQEGQVGFW----------------------------LTENQGGPKSM----C---PL 275
            .:.:.||...||:..|                            |.|.....:||    |   .:
Mouse   413 PNIIAGGCINGQIVLWDITAHADRIENIKTGGHRSKKTSLKPMFLLEPDSNKESMYIRHCAVSSI 477

  Fly   276 EACHREATTAICWV---------------HSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEP 325
            |..||:..|.|.|:               .|.:|.:..:.|.|.:|.:||.|.....|....|..
Mouse   478 ENGHRKVITDIHWLPDSFEINRMGSVFENRSGINCQLVTCSADCTICFWDIRPQKPAVTAAAAAS 542

  Fly   326 DPQTVQNRQDAHGVTF-------LEFEYTIPVRFI------------------------------ 353
            ...|..|..::.....       ::..:.:|..|:                              
Mouse   543 AATTATNNANSQQSPVEKKKEENIDIPFDVPSTFLHLDLSWKPLSRLKLSKGDTSLDHCPTKLSL 607

  Fly   354 ------------------------------------------------------FCTDMGYLFVG 364
                                                                  |||.   .|||
Mouse   608 GEDPFLCKIQGTSSIHIILRDKMLSQIKMVKTSEINPYQNLEAGIANILKPIEDFCTK---FFVG 669

  Fly   365 NRKGTT---------PQDT-------IVAAYQLFAGPIRCVMRNPFFVKNFLVVGDWRVRIWSEE 413
            ..:|..         ..||       .|:.|.:..|.:..:.|:|||....|.||.|.|.||.||
Mouse   670 TEEGEVIYTDWKMERDSDTGRLMAKKPVSLYTVHDGAVHTIQRSPFFNDIVLTVGGWNVAIWKEE 734

  Fly   414 VKNCPSTFYFRRPNQLLSGAWSTGRCSLFCIGDNMGNLEFWDLLMSHKRP-------ILTIKYKY 471
            |...|.......|.:..:|.||..|..:|.||...||::.||||.....|       |..|.|  
Mouse   735 VMTGPLLQTCCGPKRYTAGHWSLTRPGVFYIGREDGNVDIWDLLEKTHEPAQSQNICITMITY-- 797

  Fly   472 AVTHLVFKPDGTMLTVSLANGDCLMLRLEEGMRSATNKEKSLMMSMFEREIQRCKLLEAREEEIK 536
             :....|......:.|:...|...:|.:...:...:..|.|.:...||||::..:.::.|:|   
Mouse   798 -IKPWTFSSKQQFIAVADYYGTLHILEIPWTLSHPSLNEVSSVNYYFEREVRHLEYVQQRKE--- 858

  Fly   537 LKKRLTTIFLEEERKSREKLEAKKKKG----QAKKEMEPKVEDEATIFLRMIESDSEFSKALLEF 597
                     :.|:.|....||..|||.    :.|::||.:::.|...:|. :|....|:..|.:.
Mouse   859 ---------IREQEKIDMALELVKKKAKIYQKTKEQMEAELKLEYESYLD-LEKSVLFALGLSKV 913

  Fly   598 NE 599
            :|
Mouse   914 SE 915

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 23/115 (20%)
WD40 261..>512 CDD:225201 76/415 (18%)
WD40 279..492 CDD:295369 66/342 (19%)
WD40 repeat 284..332 CDD:293791 14/63 (22%)
WD40 repeat 386..422 CDD:293791 15/36 (42%)
WD40 repeat 429..454 CDD:293791 9/25 (36%)
Wdr63NP_766452.2 WD40 <384..>532 CDD:225201 30/148 (20%)
WD40 479..527 CDD:197651 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.