DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and Wdr60

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_006515843.1 Gene:Wdr60 MGIID:2445085 Length:1033 Species:Mus musculus

Alignment Length:631 Identity:121/632 (19%)
Similarity:204/632 (32%) Gaps:189/632 (30%)


  Fly    27 NEMILSVQPSGRLRLK--YILRNPIN-ERTQLSEQYAASSVLTHNVTLDSHGLNHYEGGWNVK-- 86
            ||..:.::..|:...|  |:..|..| ||...:|......|.|.:   ...| ....||...|  
Mouse   491 NEYDMYIRNFGKKNTKQAYVQYNEDNVERDIQTEDIETREVWTQH---PGEG-TAVSGGSEEKDF 551

  Fly    87 -EVNIMDEESTMRYRK-----------KVERD-----DSWGIEVNQLMHAAMDISSANNAVNIYE 134
             :|.::.:..|.|...           .:|.|     .||   :.:....|::||.:::.:|...
Mouse   552 SDVTVVPKIDTPRLANFLRAACQVVAVLLEEDRLAAGPSW---IPRAQDKALNISDSSSQLNTSL 613

  Fly   135 DFFV---------------------DLPEDLGRGISMKIAARGTHVFHDLWIPS--RRLMTCEWL 176
            .|..                     ||||   :..:..:.:|......|:|.||  ::::.||  
Mouse   614 PFLQSRKVSCLHASRVQRQTVVSVHDLPE---KAFAPSLDSRHLLCVWDIWQPSGPQKVLICE-- 673

  Fly   177 NNDPNQFLLFYSNRMSLTPDYTKQLNTLPDFGNDNPHAFYIWNLDDATRPAAHYDSRRVVRVAKV 241
                          ..:|......|.....|......:..:|:|.:.:| ..||     ||::..
Mouse   674 --------------SKVTCCCFSPLKAFLLFAGTVHGSVVVWDLREDSR-IHHY-----VRLSNC 718

  Fly   242 --CLRDESYMVGGLQEGQVGFWLTENQGGPKSMCPLEACHREATTAI---CWVHSKLNTE----- 296
              ..|..::...|:        ||    ......||:|....||:|.   .:|.|..:|:     
Mouse   719 FWAFRTPTFSTDGI--------LT----SVNHRSPLQAIEPVATSAYKKQSFVLSPFSTQEEMAG 771

  Fly   297 --FYSGSLD--GSIKYWDTRDL-------------LMP------VHEVLAEPDPQTVQNRQDAHG 338
              |:..|||  |.:..|...:|             |:|      ||..:.:..........:..|
Mouse   772 LSFHIASLDETGVLNVWVVVELPKADISGSMSDLGLIPGGRIKLVHSTVIQLGNSLSHKDSELWG 836

  Fly   339 VT---FLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGPIR--CVMRNPFFVKN 398
            .|   .::|..:.|..|:..||||.:....|:.......:....|....||:  .:..:||....
Mouse   837 STQTLSVKFLPSDPNHFVVGTDMGLISHSTRQDWRVSPRVFKPEQHGVRPIKVNVIDFSPFEETV 901

  Fly   399 FLV-VGDWRVRI-----------WSEEVKNCPSTFYFRRPNQLLSGAWSTGRCSLFCIGDNMGNL 451
            ||. ..|..:|:           |......          :.:.|..||..|.::|.:.|:...:
Mouse   902 FLAGCSDGSIRLHQLTSERPIMQWDNSTSG----------HAVTSLQWSPTRPAVFLVQDDASRI 956

  Fly   452 EFWDLLMSHKRPILTIKY---KYAVTHLVFKPDGTMLTVSLANGD--CLMLRLEEGMRSATNKEK 511
            ..||||.:...|:.....   |.....:|.:|:.|       :|.  .|:|....|.....|   
Mouse   957 YVWDLLENDLGPVAQQPISPDKLVAMTIVGEPEKT-------SGSFVALVLARTSGTVDVQN--- 1011

  Fly   512 SLMMSMFEREIQRCKLLEAREEEIKLKKRLTTIFLEEERKSREKLE 557
                                     ||:|.||..::|..:.|..|:
Mouse  1012 -------------------------LKRRWTTPAVDEHSQLRLLLQ 1032

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 18/77 (23%)
WD40 261..>512 CDD:225201 62/304 (20%)
WD40 279..492 CDD:295369 52/264 (20%)
WD40 repeat 284..332 CDD:293791 15/79 (19%)
WD40 repeat 386..422 CDD:293791 8/50 (16%)
WD40 repeat 429..454 CDD:293791 6/25 (24%)
Wdr60XP_006515843.1 PRP38_assoc 86..167 CDD:289628
WD40 604..1000 CDD:225201 84/450 (19%)
WD40 repeat 635..671 CDD:293791 9/39 (23%)
WD40 673..961 CDD:295369 63/332 (19%)
WD40 repeat 676..708 CDD:293791 5/32 (16%)
WD40 repeat 715..752 CDD:293791 9/49 (18%)
WD40 repeat 759..788 CDD:293791 8/29 (28%)
WD40 repeat 842..878 CDD:293791 8/36 (22%)
WD40 repeat 890..926 CDD:293791 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.