DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and wdr78

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:NP_001106504.1 Gene:wdr78 XenbaseID:XB-GENE-5890871 Length:795 Species:Xenopus tropicalis

Alignment Length:462 Identity:80/463 (17%)
Similarity:151/463 (33%) Gaps:150/463 (32%)


  Fly   113 VNQLMHAAMDISSANNAVNI-------------YEDF-FVDLPEDLGRGISMKIAARGTHVFHDL 163
            :|:|...|.|::..:|..:|             |..| |.:....:....|:|.......:||  
 Frog   419 LNRLWSFACDVTKGHNVSSISWNKKNSDLLAVGYGQFGFTEQKGGMACCWSLKNIMWPERIFH-- 481

  Fly   164 WIPSRRLMTCE-------WLNNDPNQFLL-FYSNRMSLTPDYTKQLN----TLPDFGNDNPHAFY 216
                     ||       :....||...: .|:..:::   |..|.|    .|....|.|.|...
 Frog   482 ---------CECGVTAVDFSAVHPNLLAVGMYNGTVAI---YNVQNNEDFPVLDSSDNPNKHTSP 534

  Fly   217 IWNLDDATRPAAHYDSRRVVRVAKVCLRDESYMVGGLQEGQVGFWLTENQGGPKSMCPLEACHRE 281
            :|.|.                                       |:..::|.      |.....|
 Frog   535 VWQLK---------------------------------------WIEHDRGN------LGDDKGE 554

  Fly   282 ATTAICWVHSKLNTEFYSGSLDGSIKYW------DTRDLLMPVHEVLAEPDPQTVQNRQDAHGVT 340
            ...::|              .||.|..|      |..| ||.:....:|...:: .|.::..|..
 Frog   555 ILVSVC--------------ADGRITRWHIRKGLDCND-LMKLKRTGSEKSKKS-SNEKEKKGEA 603

  Fly   341 FLE-------FEYTIPVRFIFCTDMGYLFVGNRKG------TTPQDTIVAAYQLFAGPIRCVMRN 392
            |:.       |:: :|      .|......|..:|      .:..:..:..|:...||:..:..:
 Frog   604 FISRQAPGMCFDF-LP------KDSNIYLAGTEEGHIHKCSCSYNEQFLDTYRGHKGPVYKIAWS 661

  Fly   393 PFFVKNFL-VVGDWRVRIWSEEVKNCPSTFYFRRPNQLLSGAWSTGRCSLF-CIGDNMGNLEFWD 455
            ||....|| ...||.:.:|.::|.: |...:....|.:....||.....:| .:.:|  .:|.||
 Frog   662 PFCPDVFLSCSADWCIHLWQQDVLS-PILTFSNTTNAVYDIMWSPSSALMFGAVTEN--RVEIWD 723

  Fly   456 LLMSHKRPILTIKYKYAV--THLVFKPDGTMLTVSLANGDCLMLRLEEG------MRSATNKEKS 512
            |..|...|::..:....|  |.::|          ..|.:|:::...:|      :|:.::.:.|
 Frog   724 LGTSTIDPLIVNEANPGVKLTSILF----------AKNTNCVLIGDSDGQVNVYELRNVSSSKDS 778

  Fly   513 LMMSMFE 519
            .:.::::
 Frog   779 EVNALYD 785

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 9/71 (13%)
WD40 261..>512 CDD:225201 52/280 (19%)
WD40 279..492 CDD:295369 46/236 (19%)
WD40 repeat 284..332 CDD:293791 10/54 (19%)
WD40 repeat 386..422 CDD:293791 9/37 (24%)
WD40 repeat 429..454 CDD:293791 5/26 (19%)
wdr78NP_001106504.1 WD40 359..782 CDD:225201 80/458 (17%)
WD40 431..768 CDD:295369 74/432 (17%)
WD40 repeat 435..480 CDD:293791 6/45 (13%)
WD40 repeat 487..523 CDD:293791 7/39 (18%)
WD40 repeat 613..650 CDD:293791 6/44 (14%)
WD40 repeat 656..693 CDD:293791 9/38 (24%)
WD40 repeat 698..736 CDD:293791 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.