DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10859 and dync1i1

Sequence 1:NP_001285898.1 Gene:CG10859 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster
Sequence 2:XP_017945105.1 Gene:dync1i1 XenbaseID:XB-GENE-490874 Length:714 Species:Xenopus tropicalis

Alignment Length:504 Identity:100/505 (20%)
Similarity:184/505 (36%) Gaps:99/505 (20%)


  Fly    86 KEVNIMDEESTMRYRKKVERDDSWGI--------EVNQLMHA------------AMDISSANNAV 130
            :|:..:..|....:..:.|:.||..:        |..|:.|:            .::.:.|.:: 
 Frog   256 EEMVDLKTEHDSEFENQEEKQDSREVPPRELTEEEKQQVTHSEEFLIFFDRTIRVIERALAEDS- 319

  Fly   131 NIYEDF----FVDLPEDLGRGISMKIAARGTHVFHDLWIPSRRLMTC-EWLNNDPNQFLLFYSNR 190
            ||:.|:    ..|...|:..|.::..    ...|:|......|::|| :|....|...:..|:| 
 Frog   320 NIFFDYSGRDLEDKEGDIQAGANLSF----NRQFYDEHWSKHRVVTCLDWSLQYPELMVASYNN- 379

  Fly   191 MSLTPDYTKQLNTLPDFGNDNPH----AFYIWNLD-DATRP--AAHYDSRRVVRVAKVCLR--DE 246
                             ..|.||    ...:||:. ..|.|  ..|..|    .|..||..  ..
 Frog   380 -----------------NEDAPHEPDGVALVWNMKFRKTTPEYIFHCQS----SVMSVCFARFHP 423

  Fly   247 SYMVGGLQEGQVGFWLTENQG---GPKSMCPLE-ACHREATTAICWVHSKLNTEFYSGSLDGSIK 307
            :.::||...||:..|  :|:.   .|....||. |.|......:..|.::......:.|.||.:.
 Frog   424 NLVIGGTYSGQIVLW--DNRSHRRTPVQRTPLSAAAHTHPIYCVNVVGTQNAHNLITVSTDGKLC 486

  Fly   308 YWDTRDLLMPVHEVLAEPDPQTVQNRQDAHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQ 372
            .| :.|:|....|.:     :.|.|:.....||.:.|.......|:..::.|.::...|.|:  :
 Frog   487 SW-SLDMLSAPQESM-----ELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACRHGS--K 543

  Fly   373 DTIVAAYQLFAGPIRCV----------MRNPFFVKNFLVVGDWRVRIWSEEVKNCPSTFYFRRPN 427
            ..|...::...||:..:          ..:.|...:|    ||.|::|:.: .|.|...:....:
 Frog   544 AGISEVFEGHQGPVTGINCHNAVGPIDFSHLFLTSSF----DWTVKLWTTK-HNKPLYSFEDNAD 603

  Fly   428 QLLSGAWSTGRCSLFCIGDNMGNLEFWDLLMSHKRPILT--IKYKYAVTHLVFKPDGTMLTVSLA 490
            .:....||....:||...|.||.|:.|:|....:.|..:  ::...|:..:.:...|..:.|..:
 Frog   604 YVCDVTWSPVHPALFACVDGMGRLDLWNLNNDTEVPTASTAVEGASALNRVRWAQSGKEVAVGDS 668

  Fly   491 NGDCLMLRLEEGMRSATNKEKSLMMSMFEREIQ--RCKLLEAREEEIKL 537
            .|...:  .:.|..|..:.::   .|.|.|.:.  |....|..||.::|
 Frog   669 EGRVWI--YDVGEFSIPHNDE---WSRFARTLMEIRANRGEGEEEAVEL 712

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 16/69 (23%)
WD40 261..>512 CDD:225201 52/267 (19%)
WD40 279..492 CDD:295369 43/225 (19%)
WD40 repeat 284..332 CDD:293791 9/48 (19%)
WD40 repeat 386..422 CDD:293791 8/46 (17%)
WD40 repeat 429..454 CDD:293791 8/25 (32%)
dync1i1XP_017945105.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.