DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16957 and MAPR2

DIOPT Version :10

Sequence 1:NP_609650.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001318286.1 Gene:MAPR2 / 817032 AraportID:AT2G24940 Length:100 Species:Arabidopsis thaliana


Alignment Length:102 Identity:36/102 - (35%)
Similarity:57/102 - (55%) Gaps:8/102 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DFTVRELREYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRIL---INSPEDL 133
            :||..:|.:|:||.....|.|||...::||:....:||..|....:||:|.||.|   ..:.||:
plant     2 EFTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKNEEDV 66

  Fly   134 KDSEDFDDLSDLSRNQMNTLREWEQRYKMKYPFVGKL 170
            ..|     |..|:..::|||.:||.:::.|||.||::
plant    67 SPS-----LEGLTEKEINTLNDWETKFEAKYPVVGRV 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16957NP_609650.1 Cyt-b5 74..>127 CDD:459698 20/55 (36%)
MAPR2NP_001318286.1 Cyt-b5 4..66 CDD:459698 21/61 (34%)

Return to query results.
Submit another query.