DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16957 and cyb5d2

DIOPT Version :10

Sequence 1:NP_609650.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001096144.1 Gene:cyb5d2 / 795950 ZFINID:ZDB-GENE-050506-83 Length:267 Species:Danio rerio


Alignment Length:97 Identity:31/97 - (31%)
Similarity:50/97 - (51%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 TVRELREYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILINSPEDLKDSED 138
            |..:|..|:|.:....:.:|||..::||.:...:||..|....:.|:|.||..|..  |..::..
Zfish    55 TKEQLSLYNGGKNSKGLYLAILGQVFDVEKGRKHYGPGGGYHFFTGKDASRAFITG--DFTEAGL 117

  Fly   139 FDDLSDLSRNQMNTLREWEQRYKMKYPFVGKL 170
            .:|:||.|.:|:..|.:|...|:..|..||||
Zfish   118 SNDVSDFSESQIVALYDWLSFYQRDYTPVGKL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16957NP_609650.1 Cyt-b5 74..>127 CDD:459698 16/52 (31%)
cyb5d2NP_001096144.1 Cyt-b5 55..117 CDD:459698 18/63 (29%)

Return to query results.
Submit another query.