DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16957 and Cyb5d2

DIOPT Version :10

Sequence 1:NP_609650.1 Gene:CG16957 / 34755 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001020097.2 Gene:Cyb5d2 / 192986 MGIID:2684848 Length:263 Species:Mus musculus


Alignment Length:139 Identity:39/139 - (28%)
Similarity:60/139 - (43%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 FTVRELREYDGTRADGRILVAILFNIYDVSRSVHYYGRNGVNPNYAGRDISRILINSPEDLKDSE 137
            |...||..|.|...|..:.:|:|..:||||....:|........:||||.||..:..  |..::.
Mouse    38 FLPEELARYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGAHYSGFAGRDASRAFVTG--DYSEAG 100

  Fly   138 DFDDLSDLSRNQMNTLREWEQRYKMKYPFVGKL----------------------KEKLQINEEE 180
            ..||::.||.:::.||..|...|:..|.|||:|                      .:.::.||:|
Mouse   101 LVDDINGLSSSEILTLHNWLSFYEKNYVFVGRLVGRFYRKDGLPTSELTQVEAMVTKGMEANEQE 165

  Fly   181 DFELQQADP 189
            ..|.|:..|
Mouse   166 QREKQKFPP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16957NP_609650.1 Cyt-b5 74..>127 CDD:459698 18/52 (35%)
Cyb5d2NP_001020097.2 Cyt-b5 40..101 CDD:459698 19/62 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..249
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.