DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7099 and AT1G17450

DIOPT Version :8

Sequence 1:NP_609648.1 Gene:CG7099 / 34753 FlyBaseID:FBgn0032517 Length:1906 Species:Drosophila melanogaster
Sequence 2:NP_001185022.1 Gene:AT1G17450 / 838317 AraportID:AT1G17450 Length:1844 Species:Arabidopsis thaliana

Alignment Length:2214 Identity:402/2215 (18%)
Similarity:718/2215 (32%) Gaps:812/2215 (37%)


  Fly    15 DEVALEGLEGVTLPYLWDLLARRLEFFPSPLPDRIREQTWTLLLRTPPHKIEF------FELPAE 73
            :|:..:|..|:.|..||..|:      |.||...::...|..||..|  :::|      :|    
plant    10 EEICCQGNTGIPLVSLWSRLS------PPPLSPSVKAHVWRNLLAVP--QLQFKAKNTVYE---- 62

  Fly    74 RPLMPYYDRLNDIDEQLGLPVVPEQCPYMLFPAAYVQEGDIKGNCNDFKTRKLIPSSDLHSLNAA 138
                |....:..::|.|.|                                      ||...   
plant    63 ----PSDASIQQLEEALRL--------------------------------------DLRIF--- 82

  Fly   139 QATEQWAGRLVVVASQELRETALTPESLLMPKNLPLPNYIFLEAIGRSRYSGHTTAGPWSLINYS 203
             |.|:..|..|.:...:...|.:   |.:..:        .||.:..:|.:|...    :|:  :
plant    83 -ANEKLRGNFVGLYDAQSNNTTI---SAIQRR--------VLERLAVARANGVAQ----NLL--A 129

  Fly   204 KDTGI----LFYIKNKLINLQLIIAQ----------NYNEINKGRILVSSLLMLPRF-------- 246
            |:.||    .|||...|.:..|::.|          ...:......:.::::.|.|:        
plant   130 KEFGIEGRNFFYIVKHLESRGLVVKQPAIVRTKEVDGEGDSKTTSCISTNMIYLSRYAKPLGSQQ 194

  Fly   247 -YRIYKNHS-------------------QENLEKLYLGIMR--------TPSRQVPVTEITDLLG 283
             :.|.|..|                   ::.|.|.:|..|:        |..:.:.|::|...||
plant   195 RFEICKEDSLLEQEATPAGDSLQSESTKEDTLIKDFLPAMQAICDKLEETNEKVLVVSDIKQDLG 259

  Fly   284 --------RPTNFKTKKLLVTHSFRKF--FETKQVERPVAPLTK-SGKQSKATTRKVTVIQLRNP 337
                    |......::|..:|...:|  ....:|||.:..|.: |.|....:.:|         
plant   260 YLGSHSRHRAWRSVCRRLTDSHVVEEFDAVVNNKVERCLRLLKRFSAKDFNYSGKK--------- 315

  Fly   338 DMQL----KDLYKNDDSEDNQVSEFLDLGHCFLDMPPEEEVFRAVARFGKRGLNSNELCHYTGIN 398
              ||    :.:.|.:.:               |::|.:.:::..|...|.:||...|:|...||:
plant   316 --QLLKFGRSIQKTEQT---------------LELPIDNQIYDMVDAEGSKGLAVMEVCERLGID 363

  Fly   399 ATYMRHFVKRVKKHGLVKEYS-----------EQVGKSRQFRFVAVGHLG--------------- 437
                       ||....:.||           |...|:|.||....|:.|               
plant   364 -----------KKKSYSRLYSICLKVGMHLQAESHKKTRVFRVWTSGNAGSECSDRFPEKAENRS 417

  Fly   438 ----------------------------------------------------------------- 437
                                                                             
plant   418 WENNVPINDFGTPHDTGGLTQTSIEHSIAISDADFATPARLTDSENNSGVLHFATPGRLTDSESN 482

  Fly   438 ----DLSKEDEIKKKALEIRCKDEPNITE---------------STDVLLKDLPEI--------- 474
                |.|..|..::..|..|     |:.|               |.|:.|.::..:         
plant   483 SGVPDCSPSDAKRRHVLTRR-----NLQESFHEICDKVVDTAMGSPDLALSEMNHLAPPKPAKPK 542

  Fly   475 VTNARPIAFKIKKTRAANQTQRQINRQKMIVRQIDQNCLVSLPRVLRSVQETERQAGFKDSLCRR 539
            |...:||.  ::.:|...:...::|.:|.:||......|:||        |.:|.:    .:.|:
plant   543 VHQPQPIT--VENSRRERRILERLNEEKFVVRAELHKWLLSL--------EKDRSS----KVDRK 593

  Fly   540 SLMRLLRPMVEENIINVFEITLHY-----NQRVRVYRFATHPKIGLDHAVMKREIV-----KLKS 594
            ::.|:|..:.||.:.|...|::..     ..|..|..|  ||.:    ..:.|:||     :::|
plant   594 TIDRILNRLQEEGLCNCMNISVPNVTNCGRNRSSVVVF--HPSV----QSLTRDIVGEIHDRIRS 652

  Fly   595 -NFHLITEERMKRPS-QMAP--------KERKEVLAR-RKLAPERSNAVFKTQAPKLLLARTLHE 648
             ...|..:...||.| ::.|        :...::.|| .|....|:|...   ..|::..:.||.
plant   653 FELGLRGQNLSKRKSNELIPILNDIQRGQTNVDLDARASKSGAMRANGFV---LAKMVRVKLLHC 714

  Fly   649 FLYYLHHELSPEQKPLPMSAELVQQWQKSEPALQPRQFFDEWQADETKVQPYTEDIGWRTFIPPL 713
            ||:.....||              .|..:..::.                               
plant   715 FLWDYFSSLS--------------SWDNAFSSIH------------------------------- 734

  Fly   714 PRYVDKPSGWLYFM-DAMDRMPLSLFMRICRIEREANDDLRLQLQHPIRQHYLLSQLKLETIVPR 777
                |:.|..|:.: ||...|||.||:::....::|:|     :....:|...||:|..|..  :
plant   735 ----DQKSDNLFALEDAFKAMPLELFLQVVGSTQKADD-----MMKKCKQVMRLSELPGEEY--K 788

  Fly   778 LKLQQIYVGTLR----LLNNMGLIQVSEQKLGRDSL-HRWVFLNQRTSL---------LDTTSST 828
            |.:..:..|.|.    :|..:.|||:...:|.||.: .::..|.....|         :..||:.
plant   789 LLMDTLATGRLSMLIDILRRLKLIQMVSSRLRRDEIEEKYANLTHAMELKPYIEEPVFVAATSNV 853

  Fly   829 EHNYMQVSAD-RSYTKLNFEFSSVEQLGNYWAKLQHICIYTKLGYRKSLSTQRILPARLKVLVFQ 892
                  :|.| |...:.:|..|:.:.:..||..|:: | |....:|                   
plant   854 ------MSLDFRPRIRHDFILSNRDAVDEYWLTLEY-C-YAAADHR------------------- 891

  Fly   893 PTVEFDQAVELDNGTVPGDHLGAAGLSSHLFAHQFRHWSWV--------QRQNGGKSNAAREKAK 949
                   |.:|   ..||.          :....||..||.        ||....|..|..||.|
plant   892 -------AAKL---AFPGS----------VVQEVFRFRSWASDRVMTTEQRAKLLKRIAIDEKEK 936

  Fly   950 RTVRKRAVITR--------------LKIGPR---------LAVRKARELSTGK----TLKKSSGP 987
            .:.::...|.:              .|.|.|         ||:..:...|:||    ||.|::| 
plant   937 LSFKECEKIAKDLNLTLEQVMHVYHAKHGRRVKSKSKDKHLAIDNSSSSSSGKRKRGTLVKTTG- 1000

  Fly   988 RDDIDRDALRNMRTLRVKWAPEEDRLLKMGRAVYMFIDAPTMTLALCDLAV-------------- 1038
                     ..:|::.|    :.:::|....     |||......|..|..              
plant  1001 ---------EGVRSIIV----DGEKVLNSDA-----IDASNSEKFLNSLEEHQEHNLQENSEIRD 1047

  Fly  1039 ------VCRDLIRRWLGICNKTTQACVRR-----------------------VQFMVKMKRDIPD 1074
                  .|..:|.::..  :|||....:|                       .:|...|...:|:
plant  1048 LTEDEGQCSSIINQYAS--SKTTSTPSQRFSWTDEADRKLLSQYVRHRAALGAKFHGVMWASVPE 1110

  Fly  1075 VPSWIYAMQTQPQFNTVYNERFLSQLKRDYPNKTDFQNALMTHFALMMAKLQRMIAKSQGSVSRQ 1139
            :|:...|.:.:.|.          .:|.|     .|:.|:|:...|:..:..|.:.      ::|
plant  1111 LPAPPLACKRRVQI----------LMKND-----KFRKAIMSLCNLLSERYARHLE------TKQ 1154

  Fly  1140 FLLPDTLEAFGSQLRECRSAHEEQQLLFQDPASETDLQVAVAHGVLHSNICCAKDKTLLNLQTFE 1204
            ..||           |...:|...:.|  .||.......:|..|   .:||..::|         
plant  1155 KCLP-----------ESNKSHVLVRYL--SPAIGGTDSGSVEQG---KDICFDEEK--------- 1194

  Fly  1205 IYKHFSEEVLNSAFN---KARADSLLVAVKRRNIQSAASRQISGPGHLLSSKYKYRLIYTKLTHF 1266
             :..|:|:.::.|||   :.:..:.|||.||    :.:||:.|.           |.|..:.:..
plant  1195 -WDDFNEKSISQAFNDVLELKKMAKLVAPKR----TKSSREWSN-----------RDIIDEGSEM 1243

  Fly  1267 LYDCFFALD-QKLRADQEQQLS--SPHFGQLLVMGEWLSENRLSLSLQLPTNILTVDTTTVGRQS 1328
            :.....:.| |.:..||.:..|  |.|:             ||..::: |.:....|:..|.:..
plant  1244 VPPAIHSEDIQNVSVDQVKDTSRRSGHY-------------RLHQTVR-PLDEKDNDSIQVRKSL 1294

  Fly  1329 GCNSDRILDHYSCIFDNAPQTEYSKRLEGECSGRQASRVLFHPANLSFRLPTSAYNQLSKLQLRA 1393
            ..::...|  ...:|.:.|.......|..:...|.:.|.||           :||:.|...:   
plant  1295 AVSTAAEL--LKLVFLSMPTAPGMPNLLEDTLRRYSERDLF-----------TAYSYLRDKK--- 1343

  Fly  1394 MHFFCALDALGEAITISQSRLEQFDCPFTNCIMRSGNYLNAVERIA--------HEQRPILRQLV 1450
               |....:.|:...:||:        |.:.|.:|...:|...|.|        ||     |.|:
plant  1344 ---FLVGGSGGQPFVLSQN--------FLHSISKSPFPVNTGTRAAKFSSWLFEHE-----RDLM 1392

  Fly  1451 ADALPSQQFVLESHPAGTPLT--VTNANLLPFAQQLEAFWREKQQAMELKDLGKTLAERTQHKLT 1513
            |              .|..||  :...::|.|...:        .:.|| .:..:|.|....:..
plant  1393 A--------------GGVTLTSDLQCGDILNFFSLV--------SSGEL-SISVSLPEEGVGEPG 1434

  Fly  1514 DWRSICAELLD-DEPHAWETERVQ---EYEPALNKEE---------------RARAQDVFVVHLP 1559
            |.|.:.....| :|..|..:::::   |.|....||:               .|.|.::|.....
plant  1435 DRRGLKRRADDIEESEAESSKKLKLLGEGEINFRKEKGFPGIAVSVRRATIPTANAIELFKDDDS 1499

  Fly  1560 TIG---IKVVEQPEG------KQTIDSLRTSVLDKVLKTTYWQYTENSFESLRPKLQESGYDDRA 1615
            ..|   :|..|...|      |:..:|..::|:...|..:.||...:...|:   :.||..::.:
plant  1500 RTGEFHLKWGEANSGCDSDDMKELFNSTDSTVIPSSLGDSPWQAMASFTSSI---MSESTDEEVS 1561

  Fly  1616 I---RHMEDILYHIEKHTLGVKGLELRKIFPLGDF-LLETLHLLADHNLIKRVGIVSVMYVHKNH 1676
            :   |..|.:...::|  .|.:||.:.::..|.|. ..||...:.|  :::..|:.    :..|.
plant  1562 LFSPRVFETVSNALQK--AGDQGLSIEEVHSLIDIPSQETCDCIVD--VLQTFGVA----LKVNG 1618

  Fly  1677 IRNW-VVHTFHIKR----LEREKVQPMVAAAPGTLQAVVGHKRKLEAQETSSSVPEKRVK--LME 1734
            ..|: |||:|:..:    ||.:          ||.|.   .::.|.......:|.|.|.|  :..
plant  1619 YNNFRVVHSFYRSKYFLTLEED----------GTSQK---SQQSLPVNYLERAVGEHRSKDIIAS 1670

  Fly  1735 QLSTESESDE--PGGSASK-----RPK--------RITRKEPSLE----VANATLEATRDAIAMR 1780
            ..||..:..|  .|.|..|     .|:        ..:.|.||:.    :...|.|:|.:...:.
plant  1671 SYSTSQDMREHVAGNSVHKVTILNLPETAQTSGLHEASIKAPSVTFGTGIEGETKESTSEKSPVP 1735

  Fly  1781 PQPWIRVNASLNRRVLDRWLGAVLSECIARVGCTVHSLFLRFLHLVPVD-VMFLLELLHDLGCIQ 1844
            ..||:..:.|:|:.|.|..:..||...:...|             :|.| ::.|:::|:...|.:
plant  1736 IYPWVNADGSINKIVFDGLVRRVLGTVMQNPG-------------IPEDEIINLMDILNPQSCRK 1787

  Fly  1845 LMEM 1848
            |:|:
plant  1788 LLEL 1791

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7099NP_609648.1 B-block_TFIIIC 173..249 CDD:252431 16/99 (16%)
AT1G17450NP_001185022.1 B-block_TFIIIC 105..189 CDD:252431 17/98 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR15180
Phylome 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.