DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: loqs and stau1

Sequence 1:NP_609646.1 Gene:loqs FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_012827226.1 Gene:stau1 XenbaseID:XB-GENE-920408 Length:719 Species:Xenopus tropicalis

Alignment Length:502 Identity:114/503 (23%)
Similarity:179/503 (36%) Gaps:134/503 (27%)


  Fly    33 GFAPRRHYNNLVGLGNGNAVSGSPVKGAPLGQRHVKLKKEKISAQVAQLSQPGQLQLSDVGDPAL 97
            |:.||..|               |...||:      |.:.::|....|....|:.:.:...|.|.
 Frog   229 GYPPRYFY---------------PFPVAPI------LYQVELSIGGQQFHGKGRTRQAAKHDAAA 272

  Fly    98 AGGSGLQGGVGLMGVILPSDEAL--KFVSETDANGLAMKTPVSILQELLSRRGITPGYELVQIEG 160
            .....||...      ||...|:  |...|.:.|    |:.:|.:.|:..:|.::..:|:.:..|
 Frog   273 KALKSLQHEP------LPDKPAVNGKAADEENLN----KSEISQVFEIALKRNMSVNFEVTKETG 327

  Fly   161 AIHEPTFRFRVSFKDKDTPFTAMGAGRSKKEAKHAAARALIDKLIGAQLPESPS--------SSA 217
            ..|..:|..:|...:    |...|.|:|||.:|..||.:::::|  .:||..|:        ...
 Frog   328 PPHMKSFVTKVIVGE----FLGEGEGKSKKISKKNAAISVLEEL--RKLPPLPTVEKMKPKIKKK 386

  Fly   218 GPSVTGLTVAGSGGDGNANATGGGDASDKTVGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERL 282
            ..|:..|..:...|.|.               |||..|.::...::...|.|...||.|||..|.
 Frog   387 TKSIVKLPTSPEYGQGM---------------NPISRLAQIQQAKKDKEPEYILITERGLPRRRE 436

  Fly   283 FTIACSILNYREMGKGKSKKIAKRLAAHRMW---------------MRLQE-----TPIDSGKIS 327
            |.:...:.|:...|.|.:||:|||.||..|.               ::.:|     .|.|..|::
 Frog   437 FVMQVKVGNHSAEGMGTNKKVAKRNAAENMLELLGFKVPPPPPKPALKTEEKLPLKKPGDGRKVT 501

  Fly   328 DSICGELEGEPRSSENYYGELKDIS------------------VPT----------LTTQHSNKV 364
            ..       ||.|.|:.....||..                  ||.          |.|:..|:|
 Frog   502 FY-------EPGSGEDTSNNNKDDEFRMPFHSHQQLPAGILPMVPEVAQAVGVNQGLHTKEFNRV 559

  Fly   365 --SQFHKTLKNATGKKLL-----KLQKTCLKNNKIDYIKLLGEIATENQFEVTY------VDIEE 416
              :....|:.....::||     ....|.||||......:|....|....::.|      |::|.
 Frog   560 APNPAKATVTAMIARELLYAGISPTADTILKNNNNAAGLVLHGPFTRPSEQLNYLSRVQGVEVEY 624

  Fly   417 KTF----SGQFQCLVQLSTLPVGVCHGSGPTAADAQRHAAQNALEYL 459
            |.|    ..:|..|:..|:.|..:.||.|.........||.|.|:.|
 Frog   625 KDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLL 671

Known Domains:


GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 17/68 (25%)
DSRM 250..316 CDD:238007 24/81 (30%)
DSRM 394..460 CDD:214634 19/77 (25%)
stau1XP_012827226.1 DSRM 82..>154 CDD:214634
DSRM 304..367 CDD:214634 17/67 (25%)
DSRM 404..470 CDD:238007 24/66 (36%)
Staufen_C 565..675 CDD:293091 27/108 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121668808
eggNOG 1 0.900 E1_KOG3732
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.