DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: loqs and r2d2

Sequence 1:NP_609646.1 Gene:loqs FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001162903.1 Gene:r2d2 FlyBaseID:FBgn0031951 Length:311 Species:Drosophila melanogaster

Alignment Length:273 Identity:73/274 (27%)
Similarity:101/274 (37%) Gaps:75/274 (27%)


  Fly   134 KTPVSILQELLSRRGIT-------PG--------YELVQIEGAIHEPTFRFRVSFKDKDTPFTAM 183
            |:.||.|||..:|..|.       ||        .||::||                      |:
  Fly     4 KSAVSALQEFCARTQINLPTYSFIPGEDGGYVCKVELLEIE----------------------AL 46

  Fly   184 GAGRSKKEAKHAAARALIDKLIGAQLPESPSSSAGPSVTGLTVAGSGGDGNANATGGGDASDKTV 248
            |.||||::|||.||..::.|:   ||.        |.:.||....:.||.:...|.......|. 
  Fly    47 GNGRSKRDAKHLAASNILRKI---QLL--------PGIHGLMKDSTVGDLDEELTNLNRDMVKE- 99

  Fly   249 GNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIAKRLAAHRMW 313
                  |::.|::|..|.|..|...:.|.|....|...||:.:....||...||.|::.||..|.
  Fly   100 ------LRDYCVRREMPLPCIEVVQQSGTPSAPEFVACCSVASIVRYGKSDKKKDARQRAAIEML 158

  Fly   314 M------------RLQETPIDSGKISD--SICGELEGEPRSSENYYGELK-----DISVPTLTTQ 359
            .            ::|.......|:.|  ....|||...|.....|.|||     |.:...|..:
  Fly   159 ALISSNSDNLRPDQMQVASTSKLKVVDMEESMEELEALRRKKFTTYWELKEAGSVDHTGMRLCDR 223

  Fly   360 HSNKVSQFHKTLK 372
            | |....|:.|||
  Fly   224 H-NYFKNFYPTLK 235

Known Domains:


GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 25/83 (30%)
DSRM 250..316 CDD:238007 19/78 (24%)
DSRM 394..460 CDD:214634
r2d2NP_001162903.1 DSRM 6..67 CDD:238007 25/83 (30%)
DSRM 95..158 CDD:238007 20/70 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3732
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1093169at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46205
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.