DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: loqs and Stau2

Sequence 1:NP_609646.1 Gene:loqs FlyBaseID:FBgn0032515 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001007150.1 Gene:Stau2 RGDID:621479 Length:571 Species:Rattus norvegicus

Alignment Length:366 Identity:89/367 (24%)
Similarity:145/367 (40%) Gaps:93/367 (25%)


  Fly   125 ETDANGLAMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFTAMGAGRSK 189
            :.|||    |:.:|::.|:..:|.:...:|:::..|..|..:|..|||..:    |:|.|.|.||
  Rat   201 DKDAN----KSEISLVFEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGE----FSAEGEGNSK 257

  Fly   190 KEAKHAAARALIDKLIGAQLP-----ESPS----------SSAGPSVTGLTVAGSGGDGNANATG 239
            |.:|..||..::.:|  .:||     |.|.          ..|||..         |.|.     
  Rat   258 KLSKKRAATTVLQEL--KKLPPLPVIEKPKLFFKKRPKTIIKAGPEY---------GQGM----- 306

  Fly   240 GGDASDKTVGNPIGWLQEMCMQRRWPPPSYETETEVGLPHERLFTIACSILNYREMGKGKSKKIA 304
                      |||..|.::...|:...|.|...:|.|:|..|.|.:...:.|....|.|.:||||
  Rat   307 ----------NPISRLAQIQQARKEKEPDYVLLSERGMPRRRKFVMQVKVGNEVATGTGPNKKIA 361

  Fly   305 KRLAAHRMWMRLQETPIDSGKISDSICGELEGEPRSSEN--YYGELKDISVPTLTTQHSNKVSQF 367
            |:.||..|.::|      ..|.|.|:..:|:   ::.||  :.|.......|.            
  Rat   362 KKNAAEAMLLQL------GYKASTSLQDQLD---KTGENKGWSGPKPGFPEPA------------ 405

  Fly   368 HKTLKNATGKKLLKL-----QKTCLKNNKIDYIKLLGEIATE--NQFEVTYVDIEEKTFSGQFQC 425
                 |.|.|.:|.|     |:.....:::.....||.::.:  ||...::..:|..:.:.....
  Rat   406 -----NNTPKGILHLSPDVYQEMEASRHRVTSGTTLGYLSPKDMNQPSSSFFSVESPSPTSSAPA 465

  Fly   426 ---LVQLSTLP----VGVCHGSGPTAADAQRHAAQNALEYL 459
               |:...|.|    :|: .||.||...:....::. ||||
  Rat   466 ARELLMNGTSPAAEAIGL-KGSSPTPPCSSVQPSKQ-LEYL 504

Known Domains:


GeneSequenceDomainRegion External IDIdentity
loqsNP_609646.1 DSRM 136..204 CDD:214634 20/68 (29%)
DSRM 250..316 CDD:238007 23/66 (35%)
DSRM 394..460 CDD:214634 17/76 (22%)
Stau2NP_001007150.1 DSRM 9..70 CDD:214634
DSRM 96..180 CDD:214634
DSRM 209..273 CDD:214634 21/70 (30%)
Nuclear localization signal 1 273..317 13/68 (19%)
DSRM 308..374 CDD:214634 23/72 (32%)
Nuclear localization signal 2 373..412 12/65 (18%)
Required for dendritic transport 381..571 28/147 (19%)
Staufen_C 457..524 CDD:293091 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.625 Consistency score
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.