powered by:
Protein Alignment Uvrag and cldn19
DIOPT Version :9
| Sequence 1: | NP_609632.1 |
Gene: | Uvrag / 34735 |
FlyBaseID: | FBgn0032499 |
Length: | 696 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_002937080.1 |
Gene: | cldn19 / 100490546 |
XenbaseID: | XB-GENE-954659 |
Length: | 221 |
Species: | Xenopus tropicalis |
| Alignment Length: | 42 |
Identity: | 12/42 - (28%) |
| Similarity: | 21/42 - (50%) |
Gaps: | 4/42 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 455 SESRQAANAQLLDNVSPLAV----SAALGYVAHLVQMLAIIM 492
|:|......::.|::..|.| :.||..||.|:..:.||:
Frog 56 SQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIII 97
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2896 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.860 |
|
Return to query results.
Submit another query.