DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uvrag and cldn19

DIOPT Version :9

Sequence 1:NP_609632.1 Gene:Uvrag / 34735 FlyBaseID:FBgn0032499 Length:696 Species:Drosophila melanogaster
Sequence 2:XP_002937080.1 Gene:cldn19 / 100490546 XenbaseID:XB-GENE-954659 Length:221 Species:Xenopus tropicalis


Alignment Length:42 Identity:12/42 - (28%)
Similarity:21/42 - (50%) Gaps:4/42 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 SESRQAANAQLLDNVSPLAV----SAALGYVAHLVQMLAIIM 492
            |:|......::.|::..|.|    :.||..||.|:..:.||:
 Frog    56 SQSTGQVQCKVYDSLLSLEVHIQTTRALMVVAMLLGFVGIII 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UvragNP_609632.1 Atg14 329..574 CDD:287195 12/42 (29%)
cldn19XP_002937080.1 PMP22_Claudin 4..182 CDD:389833 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2896
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.