DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG44085 and SPH1

Sequence 1:NP_001260440.1 Gene:CG44085 FlyBaseID:FBgn0264894 Length:2381 Species:Drosophila melanogaster
Sequence 2:NP_013417.3 Gene:SPH1 SGDID:S000004305 Length:530 Species:Saccharomyces cerevisiae

Alignment Length:299 Identity:64/300 (21%)
Similarity:112/300 (37%) Gaps:73/300 (24%)


  Fly  1180 SESEEESSDDEEDTPKLGARPAPLQSIKSVTNVQVYKGKTLEQHLDSESSDDEDDVTTADEMYDE 1244
            |.|.::.|.:|.:...:.|...||:.|:.|.|.:  .||.:....||.|        ||......
Yeast   277 STSRDDISRNEGELSDIEAGMKPLKIIEKVKNEK--NGKDISSLGDSGS--------TAVSFPSS 331

  Fly  1245 EEQIEEEQEGLVEEMEDDYIVEEDLSVIYEEESELERSSEYAKTVIRKDDSRSTIVDDIEKQIEE 1309
            .:.|.::.:..|      .:....:|:|.:.||.:..|.:     :|.:.|..|.:..:...   
Yeast   332 GKPITKKSDMPV------VVASPSISIIEKSESSIRESGK-----VRNNTSGETNLASVSPL--- 382

  Fly  1310 NDDDDDDEESNSVTVR------LPLR-FSFSRSSNDENIATVQVGNTTQIEEKPIIASSFSVAKV 1367
                .:.:.|:.:|..      |||: .|.|||.:.:       |||..:           :.|.
Yeast   383 ----KNTKNSSRITSEPSPREGLPLKVVSNSRSPSPQ-------GNTLPL-----------IGKF 425

  Fly  1368 ESDDEDDDCEVSVTISLSNSSRSNSVEKVAQPYRPSNAYPVEDI-----STPIKTSEEDV---SA 1424
            ..|.:....:..:|         ..|.:.|:||  :|..|..|:     .|.::...|.|   :.
Yeast   426 RQDYQASPPKKVIT---------KPVAETAKPY--ANIPPAADVLYSPTVTKMRKFREKVQKFAP 479

  Fly  1425 SFSLGMRNKFMGETIANDVTNNISRDQAKPKNDVTEVES 1463
            :..||:|.....|.:.|...|:.:.: |...|.|..|||
Yeast   480 NSGLGLRISTSEENLNNSDVNSTTHN-ANINNLVEFVES 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG44085NP_001260440.1 None
SPH1NP_013417.3 GIT 45..73 CDD:128828
GIT 89..119 CDD:128828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR21601
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.