DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG44085 and SPA2

Sequence 1:NP_001260440.1 Gene:CG44085 FlyBaseID:FBgn0264894 Length:2381 Species:Drosophila melanogaster
Sequence 2:NP_013079.1 Gene:SPA2 SGDID:S000003944 Length:1466 Species:Saccharomyces cerevisiae

Alignment Length:1418 Identity:273/1419 (19%)
Similarity:503/1419 (35%) Gaps:404/1419 (28%)


  Fly  1047 PYPYPVAPSYSQSSTEESRASS-------VLPDIIITPS-------TDDIPSQVIMKHHIRVEPR 1097
            |.|.|:....|:.|.:.:|.|:       |.|::.:.||       :.|..|:...:..::.:|.
Yeast   132 PLPQPMKQEVSKDSDDTARTSTNSSSVTQVAPNVSVQPSLVIPKMASIDWSSEEEEEEQVKEKPN 196

  Fly  1098 EPPKRAHSVEIEEVVSKPKARNICTNNHEVIDVLSQRLA-NINKIASGNTQAN------------ 1149
            ||..:..|:: |:..:||....|.|:: ::.|  ||.|| :|..:|...|..:            
Yeast   197 EPEGKQTSMD-EKKEAKPALNPIVTDS-DLPD--SQVLARDITSMARTPTTTHKNYWDVNDSPII 257

  Fly  1150 -LSKQLQKNYAGEQAKELGERSPS-ENASNSDSESEEESSDDEEDTPKLGARPAPLQSIKSVTNV 1212
             :.|.:......||.|     ||. :.|.|::..||.|....|            |..:.|..::
Yeast   258 KVDKDIDNEKGPEQLK-----SPEVQRAENNNPNSEMEDKVKE------------LTDLNSDLHL 305

  Fly  1213 QVYKGKTLEQHLDSESSDDEDDVTTADEMYDEEEQIEEEQEGLVEEMEDDYIVEEDLSVIYEEES 1277
            |:   :.|...|.|.:|:.|.:        .:||:.|:|:|   :.::.:|.::|..     ::.
Yeast   306 QI---EDLNAKLASLTSEKEKE--------KKEEKEEKEKE---KNLKINYTIDESF-----QKE 351

  Fly  1278 ELERSSEYAKTVIRKDDSRSTIVDDIEKQIEENDDDDD-------DEESNSVTVRLPLRFSFSRS 1335
            .|..:|:..:..|..::.:..| .:.|...::||:.:|       ..:.:|....:|.::..:.:
Yeast   352 LLSLNSQIGELSIENENLKQKI-SEFELHQKKNDNHNDLKITDGFISKYSSADGLIPAQYILNAN 415

  Fly  1336 S----NDENIATVQVGNTTQI-----EEKPIIASSFSVAKVESDDEDDDCEVSVTISLSNSSRSN 1391
            :    ....::.|.:|::|.|     ||...|.|..|....:.....|..:....:.|..:|.|:
Yeast   416 NLIIQFTTRLSAVPIGDSTAISHQIGEELFQILSQLSNLISQLLLSADLLQYKDQVILLKASLSH 480

  Fly  1392 SVEKVAQPYRPSNAYPVEDISTPIKTSEEDVSASFS---LGMRNKFMGETIANDVTNNISRDQAK 1453
            ::..:    |..:.|      .|:...:..|.|:.|   ..|.|......|.:| :|..|....:
Yeast   481 AITSI----RYFSVY------GPVLIPKITVQAAVSEVCFAMCNLIDSAKIKSD-SNGESTTSNE 534

  Fly  1454 PKNDVTEVESSPKEEFDFFATLMATKMQAQKMMEQSKNFWKTPDP-----------------KIV 1501
            ....|.|. |||..     .|.|.....:...:...|.|.....|                 ||.
Yeast   535 GNRQVLEY-SSPTA-----TTPMTPTFPSTSGINMKKGFINPRKPASFLNDVEEEESPVKPLKIT 593

  Fly  1502 EPAAEKPKLRPKEN--IPETKPPRPISGDMSKTEASLEAAKNSFWSTFATTSKETEPKAEQEDAA 1564
            :.|...|.:||..:  :|.|. .:|....:.........||||               :.:||  
Yeast   594 QKAINSPIIRPSSSNGVPTTS-RKPSGTGLFSLMIDSSIAKNS---------------SHKED-- 640

  Fly  1565 EEVDFWASIEKTSDKEEKQWTKKKKTVTYTPLKKEAVTTVQHWTTTFKAHLESLPMPQKAEVHFV 1629
                        :||            ..:|:|  |||:..:..::..:.:..|.:|.:|::..|
Yeast   641 ------------NDK------------YVSPIK--AVTSASNSASSNISEIPKLTLPPQAKIGTV 679

  Fly  1630 VEEKKKEIEEPQEENQGKENDFWGSVIQDKMENTDSATWERTEYNSE----PSQGVTEQPKQQDE 1690
            :         |..|||         |...|:|||:... :|::..:|    |:..:.::.||   
Yeast   680 I---------PPSENQ---------VPNIKIENTEEDN-KRSDITNEISVKPTSSIADKLKQ--- 722

  Fly  1691 DNVDFWANIESSNNCEDEEKPHNISYD--------PTKYPEEPREVDTDEEIDFWAEIEAKRKPG 1747
                    .|.|:..:...|.:.|:.:        ..|:.....:|.||:     :..:......
Yeast   723 --------FEQSSEKKSSPKENPIAKEEMDSKPKLSNKFITSMNDVSTDD-----SSSDGNENDD 774

  Fly  1748 EDDDEDVTFHKSATFWARKERQNSVEETPYKPVEIKAFRAKLPDEAAVEIDVWATLEAARGHEPE 1812
            .|||:|.|:  .|.....|...:.:|         |...:|||.. .||:|              
Yeast   775 ADDDDDFTY--MALKQTMKREGSKIE---------KNNDSKLPAN-IVELD-------------- 813

  Fly  1813 IVDPAVEEEKVLAEQFEELKHESSDEEEEVAEEEKELEQKPRDEVQESNLSHMDTMSLASMHEPA 1877
                       |.|..|.:|.||.:..:|:...|..              |.|.:.||       
Yeast   814 -----------LHESPESVKIESPESIKEITSSEMS--------------SEMPSSSL------- 846

  Fly  1878 TVYTWAPPPQEAEDNE--EETDFWADMEKERSKKEQFEEAEQKRHNYRQAMAFFNTSIDGQQSPP 1940
                   |.:..||.|  |..:..|.:|..|  |:.|:|......:........:..:.|:...|
Yeast   847 -------PKRLVEDVEPSEMPEKGASVESVR--KKNFQEPLGNVESPDMTQKVKSLGMTGKAVGP 902

  Fly  1941 QQNA---SPNRSSVILEVEEPQEVNLGP--------PG---EYQIIGEDGVVVEEH---KPE--- 1985
            :.::   ||..:..|..:....:| :||        ||   :.:.:|..|.:..:.   .||   
Yeast   903 ESDSRVESPGMTGQIKSLNMAGKV-VGPEADSRVESPGMKEQIKSLGMTGKITAQESIKSPEAAR 966

  Fly  1986 ----------------ITETDGDER-GAATPTNM-----EPQLPEVYVEPEPEVKR-------LV 2021
                            :.|::..|. |...|:||     .|.|....|....|::|       :.
Yeast   967 KLASSGEVDKIESPRMVRESESLEAVGNTIPSNMTVKMESPNLKGNTVSEPQEIRRDIASSEPIE 1031

  Fly  2022 NGLPDLAVEKFSEKPKISVRDRISAFEVIPSATNDGAKGLTKQSLSVDSAYGKGTLSRNSSTQRS 2086
            |..|...::|......::......:.|..||:......||.:.:..:.|.    .|::||.....
Yeast  1032 NVDPPKVLKKIVFPKAVNRTGSPKSVEKTPSSATLKKSGLPEPNSQIVSP----ELAKNSPLAPI 1092

  Fly  2087 ESEIEEDDSGVTDMNRQLSETDTESESFPELRKMTSYQRAATHSRLFKLLQDENDVPEAGAQPAD 2151
            :..:|     :.:.|:..:||.|..|  |..:...:..|.|..:|..|  ::|.|         :
Yeast  1093 KKNVE-----LRETNKPHTETITSVE--PTNKDANTSWRDADLNRTIK--REEED---------E 1139

  Fly  2152 EFQFKPSRRKIVHNVSITRRQNPGALNEAETMTQRRERLSLPLRKNTSIDADNPSTPN--SPASP 2214
            :|.      ::.||:.||         .|.|.|.:.:...:|:.:....:|:..::..  ..::.
Yeast  1140 DFD------RVNHNIQIT---------GAYTKTGKIDYHKIPVDRKAKSEAEVHTSEEDIDESNN 1189

  Fly  2215 IMGPSAKNQRVVSDK---LVNELVQSLLLK-SDSSHLRNLPMERLQAAAKRALVEEMDSAQENSS 2275
            :.|..|..|..::::   .||....|.:.| |.|..|.:.|:             :.::::.|..
Yeast  1190 VNGKRADAQIHITERKHAFVNPTENSQVKKTSHSPFLNSKPV-------------QYENSESNGG 1241

  Fly  2276 LDS-----TPAPTPKHD-KEYSDYYNSWCDASGSGDEVLPSKSFRALQDPRRS 2322
            :::     ....|..|| |.||       |...|..:.:|.|.....|:..||
Yeast  1242 INNHIKIKNTGETTAHDEKHYS-------DDDDSSYQFVPMKHEEQEQEQNRS 1287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG44085NP_001260440.1 None
SPA2NP_013079.1 GIT_SHD 44..71 CDD:285690
GIT_SHD 94..122 CDD:285690
GIT_SHD 337..366 CDD:305038 5/34 (15%)
DUF4573 876..1042 CDD:291798 29/167 (17%)
DUF4573 974..1137 CDD:291798 35/176 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21601
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.