DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG44085 and SPAC3G9.05

Sequence 1:NP_001260440.1 Gene:CG44085 FlyBaseID:FBgn0264894 Length:2381 Species:Drosophila melanogaster
Sequence 2:NP_594077.1 Gene:SPAC3G9.05 PomBaseID:SPAC3G9.05 Length:659 Species:Schizosaccharomyces pombe

Alignment Length:780 Identity:142/781 (18%)
Similarity:260/781 (33%) Gaps:274/781 (35%)


  Fly   843 RSFKILQAMTTPE--------NADHKIHTELDSDLENVELNE-----SPNNNNNNNNNSNNGSTE 894
            |.::.|.....||        ||:.:...:|.. |.:::.:|     :.......||:.......
pombe     7 RQYRFLARYLEPEFVKDPALRNANARPREKLQR-LSHIQFSELLTDVADELQRRINNDPKVRFLP 70

  Fly   895 NNNNYNNKINSKTNKRHSYTSSTPTSSPSTCTDP--TIHSSNSSLSSD--SSCPPQPPRSQSVPP 955
            ..::|:.|.|   :.|...:|..||.....|.|.  .:.|..|....:  |:.||...|:.|.||
pombe    71 PVDSYHPKRN---HARQKLSSLAPTRLRDLCMDVFFEVQSRYSGALKEVSSNTPPNMTRAASQPP 132

  Fly   956 QYPYAFGYPYPWYMPPPPPVNGEGAPWPYPYSYPPPPPPQSIDGKQAEGFPPYPYYYPYYPPPLP 1020
                                                                             
pombe   133 ----------------------------------------------------------------- 132

  Fly  1021 PYGQQPGEAQIPPGYPQFHAMPPYGHPYPYPVAPSYSQSSTEESRASSVLPDIIITPSTDDIPSQ 1085
                           ||...:|        ..||.:...|:..:.::|:.|....|.|:..|||.
pombe   133 ---------------PQVQRLP--------ASAPKHDLYSSANASSASLHPTEQRTTSSPTIPSY 174

  Fly  1086 VIMKHHIRVEPREPPKRAHSVEIEEVVSKPKARNICTNNHEVIDVLSQRLANINKIASGNTQANL 1150
            .              .|.|:       ..|.:             ||.||.|:....:.||    
pombe   175 A--------------NRTHT-------DSPTS-------------LSHRLPNVPDTNALNT---- 201

  Fly  1151 SKQLQKNYAGEQAKELGERSPSENASNSDSESEEESSDDEEDTPKLGARPAPLQSI--KSVTNVQ 1213
               :|.|.:...:...|.::..:::||..|..|...|...:....|.:..:.::::  ||:::..
pombe   202 ---VQANNSSTSSLSQGAQTGIDSSSNYLSRIEMLESSLAKSNSLLDSSKSEMEALKAKSISDAT 263

  Fly  1214 VYKGK--TLEQHLDSESSDDEDDVTTADEMYDEEEQIEE-------------------EQEGLV- 1256
            .:|.:  .||:.|...|.:.|..:   .::.|.|.:|:|                   .||.:| 
pombe   264 KHKNEIFQLEEKLHEASHEAEISI---KKLNDAENRIKELENNPTLSFNPELEKNLKLMQELIVA 325

  Fly  1257 EEMEDDYIVEEDLSVIYEEESELERSSEY---AKTVIRKDDSR----STI-VDDIEKQIEENDDD 1313
            |..:..:|||.: |.|...::|.||..:.   ||:....:|.|    :|: :..|.:.|..|...
pombe   326 ESSKTQHIVELE-SCIDSLKAETERWKKVAINAKSAKIDEDIRLFTMTTVPMKSIRELISPNGFL 389

  Fly  1314 DDDEESNSVTVRLPLRF---------SFSRSSNDENIATVQ------------VGNTTQIEEKPI 1357
            |:         :|.:|:         |..|.|..:.::|.:            :...:.:||.|.
pombe   390 DE---------QLYIRYFVEMNVFVASLRRDSPSQWMSTAKDIALTLEAIVSSLREKSLLEELPD 445

  Fly  1358 IAS------SFSVAKVES--------------DDEDDDCEVSV-------TISLSNSSRSN-SVE 1394
            :..      ||:.:.:|.              ..:...|.:|:       |..|:|:.:|: ||.
pombe   446 LGKKVDDLCSFTNSLMEQVRLAVINGALLPIYHVDASACSISISLMDIAKTYGLTNTGKSSLSVG 510

  Fly  1395 KVAQPYRPSNAYPVEDIS--TPIKTSEEDVSASFSLGMRNKFMGETIANDVTNNISRDQAKPKND 1457
            :       ::.:||:|:.  :..||...:.|..||  ..|:.:.:.|::|  ::.|..|.:...|
pombe   511 R-------NSLHPVDDLKALSVAKTLLSEKSKQFS--ETNQKLLDAISSD--SSSSTIQQRVHED 564

  Fly  1458 VTEVE------SSPKEEFDFFA-------TLMATKMQAQKMMEQ---SKNFWKTPDPKIVEPAAE 1506
            :..:.      |||.|.....|       .|...:....:::||   .:||..| |...|.|..:
pombe   565 INVIRDTLFDVSSPLELMRDRAAYAVIHNALQEMRRYCMQLIEQEGHGENFGFT-DNNSVPPLTD 628

  Fly  1507  1506
            pombe   629  628

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG44085NP_001260440.1 None
SPAC3G9.05NP_594077.1 GIT_SHD 34..61 CDD:285690 3/28 (11%)
GIT 82..112 CDD:128828 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR21601
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.